Property Summary

NCBI Gene PubMed Count 14
PubMed Score 0.71
PubTator Score 0.70

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
astrocytoma 1.400 2.4e-15
atypical teratoid / rhabdoid tumor 1.300 1.6e-04
Breast cancer 2.400 2.6e-02
colon cancer 1.300 2.4e-03
glioblastoma 1.300 5.4e-05
group 3 medulloblastoma 1.600 2.3e-03
malignant mesothelioma 1.100 7.4e-05
medulloblastoma, large-cell 1.600 7.6e-04
oligodendroglioma 1.500 2.2e-11
osteosarcoma -1.213 1.7e-02
pediatric high grade glioma 1.100 6.4e-03
pituitary cancer 1.200 6.7e-04
posterior fossa group B ependymoma 1.200 1.0e-04
primitive neuroectodermal tumor 1.800 2.4e-06
tuberculosis -1.300 2.2e-03

AA Sequence

MKRHRPVSSSDSSDESPSTSFTSGSMYRIKSKIPNEHKKPAEVFRKDLISAMKLPDSHHINPDSYYLFAD      1 - 70
TWKEEWEKGVQVPASPDTVPQPSLRIIAEKVKDVLFIRPRKYIHCSSPDTTEPGYINIMELAASVCRYDL     71 - 140
DDMDIFWLQELNEDLAEMGCGPVDENLMEKTVEVLERHCHENMNHAIETEEGLGIEYDEDVICDVCRSPD    141 - 210
SEEGNDMVFCDKCNVCVHQACYGILKVPEGSWLCRSCVLGIYPQCVLCPKKGGALKTTKTGTKWAHVSCA    211 - 280
LWIPEVSIACPERMEPITKISHIPPSRWALVCNLCKLKTGACIQCSIKSCITAFHVTCAFEHGLEMKTIL    281 - 350
DEGDEVKFKSYCLKHSQNRQKLGEAEYPHHRAKEQSQAKSEKTSLRAQKLRELEEEFYSLVRVEDVAAEL    351 - 420
GMPTLAVDFIYNYWKLKRKSNFNKPLFPPKEDEENGLVQPKEESIHTRMRMFMHLRQDLERVRNLCYMIS    421 - 490
RREKLKLSHNKIQEQIFGLQVQLLNQEIDAGLPLTNALENSLFYPPPRITLKLKMPKSTPEDHRNSSTET    491 - 560
DQQPHSPDSSSSVHSIRNMQVPQESLEMRTKSYPRYPLESKNNRLLASLSHSRSEAKESSPAWRTPSSEC    561 - 630
YHGQSLGKPLVLQAALHGQSSIGNGKSQPNSKFAKSNGLEGSWSGNVTQKDSSSEMFCDQEPVFSPHLVS    631 - 700
QGSFRKSTVEHFSRSFKETTNRWVKNTEDLQCYVKPTKNMSPKEQFWGRQVLRRSAGRAPYQENDGYCPD    701 - 770
LELSDSEAESDGNKEKVRVRKDSSDRENPPHDSRRDCHGKSKTHPLSHSSMQR                     771 - 823
//

Text Mined References (23)

PMID Year Title