Property Summary

NCBI Gene PubMed Count 29
PubMed Score 33.32
PubTator Score 28.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
chronic lymphosyte leukemia -1.100 5.3e-09
sonic hedgehog group medulloblastoma -2.300 1.4e-04
periodontitis 1.200 1.7e-23
atypical teratoid / rhabdoid tumor -1.900 4.1e-03
medulloblastoma, large-cell -2.800 2.0e-05
primitive neuroectodermal tumor -1.200 1.2e-02
chronic kidney disease 1.100 4.3e-02
lung cancer 2.000 7.5e-04
colon cancer -2.100 7.2e-04
lung carcinoma 1.400 1.2e-13
ovarian cancer 1.400 6.2e-05
pituitary cancer -1.400 2.1e-03

Gene RIF (2)

PMID Text
20198315 Observational study of gene-disease association. (HuGE Navigator)
19851296 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MVKISFQPAVAGIKGDKADKASASAPAPASATEILLTPAREEQPPQHRSKRGGSVGGVCYLSMGMVVLLM      1 - 70
GLVFASVYIYRYFFLAQLARDNFFRCGVLYEDSLSSQVRTQMELEEDVKIYLDENYERINVPVPQFGGGD     71 - 140
PADIIHDFQRGLTAYHDISLDKCYVIELNTTIVLPPRNFWELLMNVKRGTYLPQTYIIQEEMVVTEHVSD    141 - 210
KEALGSFIYHLCNGKDTYRLRRRATRRRINKRGAKNCNAIRHFENTFVVETLICGVV                 211 - 267
//

Text Mined References (31)

PMID Year Title
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
21269460 2011 Initial characterization of the human central proteome.
20198315 2010 Association of genetic variants with hemorrhagic stroke in Japanese individuals.
19851296 2010 Assessment of a polymorphism of SDK1 with hypertension in Japanese Individuals.
19849849 2009 CD74 interacts with APP and suppresses the production of Abeta.
19366692 2009 BRI3 inhibits amyloid precursor protein processing in a mechanistically distinct manner from its homologue dementia gene BRI2.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
19114711 2009 Substrate requirements for SPPL2b-dependent regulated intramembrane proteolysis.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18452648 2008 BRI3 associates with SCG10 and attenuates NGF-induced neurite outgrowth in PC12 cells.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16341674 2005 Transcriptome analysis of human gastric cancer.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15606899 2005 Beta-amyloid protein converting enzyme 1 and brain-specific type II membrane protein BRI3: binding partners processed by furin.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14592447 2003 bri3, a novel gene, participates in tumor necrosis factor-alpha-induced cell death.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11290423 2001 Sequence, genomic structure and tissue expression of Human BRI3, a member of the BRI gene family.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11042152 2000 Cloning and functional analysis of cDNAs with open reading frames for 300 previously undefined genes expressed in CD34+ hematopoietic stem/progenitor cells.
9653160 1998 Identification of genes expressed in human CD34(+) hematopoietic stem/progenitor cells by expressed sequence tags and efficient full-length cDNA cloning.
8702637 1996 Isolation of markers for chondro-osteogenic differentiation using cDNA library subtraction. Molecular cloning and characterization of a gene belonging to a novel multigene family of integral membrane proteins.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
7938007 1994 A catalogue of genes in the cardiovascular system as identified by expressed sequence tags.
7757816 1995 [IMAGE: molecular integration of the analysis of the human genome and its expression].
7566098 1995 Initial assessment of human gene diversity and expression patterns based upon 83 million nucleotides of cDNA sequence.