Property Summary

NCBI Gene PubMed Count 40
PubMed Score 21.67
PubTator Score 15.64

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
astrocytic glioma 1.900 2.0e-02
ependymoma 2.200 8.7e-03
oligodendroglioma 1.100 2.5e-02
psoriasis -1.100 2.3e-04
glioblastoma 2.300 5.7e-06
osteosarcoma 3.398 4.3e-03
cystic fibrosis 1.267 1.3e-03
atypical teratoid/rhabdoid tumor 1.300 3.7e-05
medulloblastoma, large-cell -2.800 2.3e-02
primitive neuroectodermal tumor 1.400 3.1e-03
tuberculosis -6.000 4.8e-11
non-small cell lung cancer 1.573 2.3e-07
colon cancer -2.100 1.3e-02
lung cancer -1.800 3.2e-04
pediatric high grade glioma 1.800 1.8e-05
pilocytic astrocytoma 1.800 2.3e-05
lung carcinoma -2.300 4.9e-18
spina bifida -2.087 4.6e-02
Breast cancer -2.300 4.0e-05
ovarian cancer 1.700 1.8e-03

Protein-protein Interaction (11)

Gene RIF (27)

PMID Text
27157394 Integrin beta8 was differentially expressed between Fibromyalgia patients and healthy controls.
26901152 Integrins alphavbeta6 and alphavbeta8 were expressed in non-overlapping patterns by keratinocytes and maintained the epidermal residence of Langerhans cells and tissue resident memory T cells by activating latent TGF-beta.
26157134 Herpes simplex virus entry is enabled by gH/gL interaction with alphavbeta6- or alphavbeta8-integrin receptors.
25886373 Integrin Beta8 plays a role in the motility of prostate cancer cells.
25190218 overexpression of integrin alphav induces integrin alphavb8 heterodimer formation and the binding of integrin alphavbeta8 to type collagen might enhance the proliferation and invasion of SCC cells via the activation of the MEK/ERK signaling pathway.
25079481 data show that integrin beta 8, but not integrin beta 5 or integrin beta 6, protein expression is increased in liver specimens of patients with biliary atresia
24367260 alphavbeta6- and alphavbeta8-integrins acted independently and are thus interchangeable as receptors for Herpes simplex type 1 virus entry.
24294359 Brain metastases ITGB8 expression exhibits considerable heterogeneity according to tumor origin.
23874518 Desmoglein-2 co-localizes with integrin-beta8 in N-MVECs.
23283986 alphavbeta8 integrin, via interactions with RhoGDI1, regulates activation of Rho proteins to promote glioblastoma multiforme cell invasiveness.
22753015 ITGB8 silencing may change lung cancer cells to a less invasive phenotype through alteration in the expression of metastasis-related genes.
22279205 Deletion of the Itgb8 gene from retinal ganglia cells and Mu ller glia, but not astrocytes, results in highly abnormal vascular patterning and instability.
21878622 Interleukin-1beta induces increased transcriptional activation of the transforming growth factor-beta-activating integrin subunit beta8 through altering chromatin architecture.
21859829 Highly angiogenic and poorly invasive glioblastomas expressed low levels of beta8 integrin, whereas highly invasive glioblastomas with limited neovascularization expressed high levels of beta8 integrin.
21646718 Data suggest that lung fibroblast chemokine secretion directs dendritic cell trafficking, in a manner that is critically dependent on alphavbeta8-mediated activation of TGF-beta by fibroblasts.
21178476 The authors demonstrated that both integrins alphavbeta6 and alphavbeta8 can serve as specific receptors for Epstein-Barr virus gHgL proteins.
20956944 miR-93 promotes the growth of, and angiogenesis in astrocytomas, by suppressing, at least in part, integrin-beta8 expression.
20942236 The mRNA levels of IntegrinalphaV and Integrinbeta8 were significantly higher in LSCC tissues than that in corresponding adjacent normal tissues.
20519498 Transcription of the transforming growth factor beta activating integrin beta8 subunit is regulated by SP3, AP-1, and the p38 pathway
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
20019187 Reduced expression of integrin beta8 may be involved in the pathogenesis of sporadic brain arteriovenous malformations.
19920174 Fusion of epithelial cells by Epstein-Barr virus proteins is triggered by binding of viral glycoproteins gHgL to integrins alphavbeta6 or alphavbeta8.
18549475 Observational study of gene-disease association. (HuGE Navigator)
16702213 periostin has an active role in the epithelial-mesenchymal transformation and metastasis that requires cross-talk between integrin and EGFR signaling pathways
12875973 These data provide evidence for a functional role for integrin alphavbeta8-mediated activation of transforming growth factor-beta in control of human airway epithelial proliferation in vivo.
12324452 induced alpha(v)beta(8) integrin expression mediated Fas-stimulated migration

AA Sequence

MCGSALAFFTAAFVCLQNDRRGPASFLWAAWVFSLVLGLGQGEDNRCASSNAASCARCLALGPECGWCVQ      1 - 70
EDFISGGSRSERCDIVSNLISKGCSVDSIEYPSVHVIIPTENEINTQVTPGEVSIQLRPGAEANFMLKVH     71 - 140
PLKKYPVDLYYLVDVSASMHNNIEKLNSVGNDLSRKMAFFSRDFRLGFGSYVDKTVSPYISIHPERIHNQ    141 - 210
CSDYNLDCMPPHGYIHVLSLTENITEFEKAVHRQKISGNIDTPEGGFDAMLQAAVCESHIGWRKEAKRLL    211 - 280
LVMTDQTSHLALDSKLAGIVVPNDGNCHLKNNVYVKSTTMEHPSLGQLSEKLIDNNINVIFAVQGKQFHW    281 - 350
YKDLLPLLPGTIAGEIESKAANLNNLVVEAYQKLISEVKVQVENQVQGIYFNITAICPDGSRKPGMEGCR    351 - 420
NVTSNDEVLFNVTVTMKKCDVTGGKNYAIIKPIGFNETAKIHIHRNCSCQCEDNRGPKGKCVDETFLDSK    421 - 490
CFQCDENKCHFDEDQFSSESCKSHKDQPVCSGRGVCVCGKCSCHKIKLGKVYGKYCEKDDFSCPYHHGNL    491 - 560
CAGHGECEAGRCQCFSGWEGDRCQCPSAAAQHCVNSKGQVCSGRGTCVCGRCECTDPRSIGRFCEHCPTC    561 - 630
YTACKENWNCMQCLHPHNLSQAILDQCKTSCALMEQQHYVDQTSECFSSPSYLRIFFIIFIVTFLIGLLK    631 - 700
VLIIRQVILQWNSNKIKSSSDYRVSASKKDKLILQSVCTRAVTYRREKPEEIKMDISKLNAHETFRCNF     701 - 769
//

Text Mined References (41)

PMID Year Title
27157394 Genome-wide expression profiling in the peripheral blood of patients with fibromyalgia.
26901152 2016 Stromal cells control the epithelial residence of DCs and memory T cells by regulated activation of TGF-?.
26157134 2015 Dissociation of HSV gL from gH by ?v?6- or ?v?8-integrin promotes gH activation and virus entry.
25886373 2015 The tumour-promoting receptor tyrosine kinase, EphB4, regulates expression of integrin-?8 in prostate cancer cells.
25190218 2014 Overexpression of integrin ?v facilitates proliferation and invasion of oral squamous cell carcinoma cells via MEK/ERK signaling pathway that is activated by interaction of integrin ?v?8 with type ? collagen.
25079481 2014 Integrin ?-8, but not ?-5 or -6, protein expression is increased in livers of children with biliary atresia.
24367260 2013 ?v?6- and ?v?8-integrins serve as interchangeable receptors for HSV gH/gL to promote endocytosis and activation of membrane fusion.
24312400 2013 The changing integrin expression and a role for integrin ?8 in the chondrogenic differentiation of mesenchymal stem cells.
24294359 2013 Comparing the expression of integrins ?v?3, ?v?5, ?v?6, ?v?8, fibronectin and fibrinogen in human brain metastases and their corresponding primary tumors.
23874518 2013 Desmoglein-2-integrin Beta-8 interaction regulates actin assembly in endothelial cells: deregulation in systemic sclerosis.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23283986 2013 ?v?8 integrin interacts with RhoGDI1 to regulate Rac1 and Cdc42 activation and drive glioblastoma cell invasion.
22753015 2012 Alteration in metastasis potential and gene expression in human lung cancer cell lines by ITGB8 silencing.
22279205 2012 Defective retinal vascular endothelial cell development as a consequence of impaired integrin ?V?8-mediated activation of transforming growth factor-?.
21878622 2011 Interleukin-1beta induces increased transcriptional activation of the transforming growth factor-beta-activating integrin subunit beta8 through altering chromatin architecture.
21859829 2011 Glioblastoma angiogenesis and tumor cell invasiveness are differentially regulated by ?8 integrin.
21646718 2011 Mouse and human lung fibroblasts regulate dendritic cell trafficking, airway inflammation, and fibrosis through integrin ?v?8-mediated activation of TGF-?.
21178476 Integrins as triggers of Epstein-Barr virus fusion and epithelial cell infection.
20956944 2011 MicroRNA miR-93 promotes tumor growth and angiogenesis by targeting integrin-?8.
20942236 2010 [Expression and significance of integrins subunits in laryngeal squamous cell carcinoma].
20519498 2010 Transcription of the transforming growth factor beta activating integrin beta8 subunit is regulated by SP3, AP-1, and the p38 pathway.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20019187 2010 Reduced expression of integrin alphavbeta8 is associated with brain arteriovenous malformation pathogenesis.
19920174 2009 Fusion of epithelial cells by Epstein-Barr virus proteins is triggered by binding of viral glycoproteins gHgL to integrins alphavbeta6 or alphavbeta8.
19267251 2009 Cooperation between integrin alphavbeta3 and VEGFR2 in angiogenesis.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18549475 2008 Genome wide SNP comparative analysis between EGFR and KRAS mutated NSCLC and characterization of two models of oncogenic cooperation in non-small cell lung carcinoma.
16702213 2006 Transduction of a mesenchyme-specific gene periostin into 293T cells induces cell invasive activity through epithelial-mesenchymal transformation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12875973 2003 Integrin alphavbeta8-mediated activation of transforming growth factor-beta inhibits human airway epithelial proliferation in intact bronchial tissue.
12853948 2003 The DNA sequence of human chromosome 7.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12324452 2002 Fas activation induces renal tubular epithelial cell beta 8 integrin expression and function in the absence of apoptosis.
11970960 2002 The integrin alpha(v)beta8 mediates epithelial homeostasis through MT1-MMP-dependent activation of TGF-beta1.
11156415 2000 A role for the integrin alphavbeta8 in the negative regulation of epithelial cell growth.
9847074 1998 Toward a complete human genome sequence.
9252563 1997 Expression of integrin cell adhesion receptors during human airway epithelial repair in vivo.
7525578 1994 Integrin alpha v beta 8. Interaction with vitronectin and functional divergence of the beta 8 cytoplasmic domain.
1918072 1991 Cloning and expression of a divergent integrin subunit beta 8.