Property Summary

NCBI Gene PubMed Count 65
PubMed Score 35.40
PubTator Score 20.79

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -1.897 2.3e-07
interstitial cystitis 1.200 5.5e-03

Gene RIF (52)

PMID Text
26348893 CCR9 and Integrin-beta7 expression has a differential effect on graft fate during acute graft-versus-host disease (GVHD) of the liver depending on the GVHD target tissue.
26105197 Collectively, these data suggest a role for alpha4beta7 integrin in HIV infection that is influenced by both viral and host factors including the sequence of the HIV gp120 alpha4beta7 binding motif, the cytokine milieu and bacterial vaginosis in the genital tract.
26105197 HIV-1 Env gp120 with P/SDI/V-ITGA4/ITGB7 binding motifs interact more with ITGA4/ITGB7
26018157 HIV-1 Env gp120 with P/SDI/V-ITGA4/ITGB7 binding motifs interact more with ITGA4/ITGB7
25527342 Knockdown of integrin, beta 7 (ITGB7) by shRNA library screening inhibits HIV-1 replication in cultured Jurkat T-cells
25265384 HIV-1 Env gp120 with P/SDI/V-ITGA4/ITGB7 binding motifs interact more with ITGA4/ITGB7
25008916 HIV-1 virions and many gp120s lack detectable alpha4beta7 binding activity.
25008916 HIV-1 Env gp120 with P/SDI/V-ITGA4/ITGB7 binding motifs interact more with ITGA4/ITGB7
24829201 circulating trisomy 12 CLL cells also have increased expression of the integrins CD11b, CD18, CD29, and ITGB7, and the adhesion molecule CD323.
24802248 Disruption of the hydrophobic contacts induces the active conformation of integrin alpha 4 beta 7.
24606696 Only rotavirus specific CD4 T cells expressed intestinal homing receptors alpha4beta7 and CCR9.
24387749 HIV-1 Env gp120 with P/SDI/V-ITGA4/ITGB7 binding motifs interact more with ITGA4/ITGB7
24369910 HIV-1 Env gp120 with P/SDI/V-ITGA4/ITGB7 binding motifs interact more with ITGA4/ITGB7
24312168 HIV-1 Env gp120 with P/SDI/V-ITGA4/ITGB7 binding motifs interact more with ITGA4/ITGB7
24191938 HIV-1 Env gp120 with P/SDI/V-ITGA4/ITGB7 binding motifs interact more with ITGA4/ITGB7
24162774 Data indicate that signaling by HIV-1 gp120 through integrin alpha4beta7 resulted in increased expression of the immunosuppressive cytokine TGF-beta1 and FcRL4.
24162774 HIV-1 Env gp120 with P/SDI/V-ITGA4/ITGB7 binding motifs interact more with ITGA4/ITGB7
24158809 HIV-1 Env gp120 with P/SDI/V-ITGA4/ITGB7 binding motifs interact more with ITGA4/ITGB7
23986478 Two conserved disulfide bonds located at integrin alpha4C589-C594 and beta7C494-C526 activated alpha4beta7.
23553626 analysis of the molecular basis for alpha4beta7-mediated rolling cell adhesion and a novel regulatory element of integrin affinity and signaling
22908191 HIV-1 Env gp120 with P/SDI/V-ITGA4/ITGB7 binding motifs interact more with ITGA4/ITGB7
22822002 Integrin alpha4beta7 binds gp120 but does not mediate HIV envelope-induced death signaling.
22418441 Data suggest that monoclonal antibody J19 is a potentially powerful tool for both studies on alpha(4)beta(7) activation mechanism and development of novel therapeutics targeting the activated lymphocyte expressing high affinity alpha(4)beta(7).
21926999 Consistent with structural predictions, strain increases beta-integrin binding to FLNA, whereas it causes FilGAP to dissociate from FLNA, providing a direct and specific molecular basis for cellular mechanotransduction
21926353 HIV-1 Env gp120 with P/SDI/V-ITGA4/ITGB7 binding motifs interact more with ITGA4/ITGB7
21474670 a role for integrin-beta7 in MM-cell adhesion, migration, and BM homing, and pave the way for a novel therapeutic approach targeting this molecule.
21430257 findings indicate that alpha4beta7*IgG can be used as a probe for functional MAdCAM-1 expressed on HEVs in GALT and could potentially serve as an anti-inflammatory drug inhibiting GALT-specific lymphocyte migration
21417760 HIV-1 Env gp120 with P/SDI/V-ITGA4/ITGB7 binding motifs interact more with ITGA4/ITGB7
21398606 Data show that integrin beta7 and CCR6 identify four distinct stages of memory CD4+ T cell differentiation.
21383973 HIV-1 Env gp120 with P/SDI/V-ITGA4/ITGB7 binding motifs interact more with ITGA4/ITGB7
21357540 The entry of recently activated CD4-expressing T cells into the bone marrow can occur in a transgenic beta1- and beta7-integrin-independent manner following Listeria monocytogenes infection.
21296888 Findings suggest that the inactive alpha4beta7 and alpha4beta7 activated by different stimuli have distinct conformations with different structural requirements for MAdCAM-1 binding.
21284901 HIV-1 Env gp120 with P/SDI/V-ITGA4/ITGB7 binding motifs interact more with ITGA4/ITGB7
21075690 The proportion of all B cells expressing alpha4beta7 was highest in early infancy. Nearly all naive B cells in all age groups expressed alpha4beta7, whereas the expression on class-switched B cells decreased with age.
19933330 The specific affinity of gp120 for alpha(4)beta(7) provides a mechanism for HIV-1 to target activated cells that are critical for efficient virus propagation and dissemination following sexual transmission.
19864932 HIV-1 Env gp120 with P/SDI/V-ITGA4/ITGB7 binding motifs interact more with ITGA4/ITGB7
19795986 HIV-1 Env gp120 with P/SDI/V-ITGA4/ITGB7 binding motifs interact more with ITGA4/ITGB7
19699211 Mechanical force applied to filamin can expose cryptic integrin binding sites.
19460752 Knockdown of integrin, beta 7 (ITGB7) by shRNA library screening inhibits HIV-1 replication in cultured Jurkat T-cells
18829455 analysis of the migfilin-filamin interaction and competition with integrin beta 7 tails
18264102 HIV-1 Env gp120 with P/SDI/V-ITGA4/ITGB7 binding motifs interact more with ITGA4/ITGB7
17490615 Taken together, these data establish beta7 ITG as a new molecular target of PAHs, whose up-regulation by these environmental contaminants most likely requires activation of co-operative pathways involving both AhR and c-maf.
17325197 Cadherin-E interaction with integrin alphaEbeta7 causes antitumor cytotoxic response by CD8+/CD103+ tumor-reactive T lymphocytes.
16874740 quasi-palindromic sequence YDRREY within the beta7 cytoplasmic tail constitutes a cell adhesion regulatory domain that modulates the interaction of beta7-expressing leukocytes with their endothelial and epithelial ligands
16818733 Beta7 integrin is a major galectin-1-glycosylated counterreceptor involved in immune developmental synapse formation.
16177076 Integrin activation marker CD103 (alphaEbeta7) is expressed on Epstein-Barr virus-specific tonsil-resident (but not peripheral blood mononuclear leukocyte-derived) cytotoxic T lymphocytes.
15749880 analyzed the rotavirus-specific VH and VL repertoire in IgD- B cells expressing the intestinal homing marker alpha4beta7
15699171 In a chronic ileitis model, pathogenic CD4+ T cells use the integrin beta 7/MAdCAM-1 pathway in order to recirculate to the chronically inflamed small intestine.
15663557 Observational study of gene-disease association. (HuGE Navigator)
15448154 metal ion binding sites in the I-like domain and the interface with the hybrid domain are important for rolling and firm adhesion by integrin alpha4beta7
14608374 bipolar metal ion cluster sites stabilize two alternative phases of adhesion
12682249 T cell stimulation leads to incresed phosphorylation of integrin beta 7 and reveals threonine phosphorylation of beta 7.

AA Sequence

MVALPMVLVLLLVLSRGESELDAKIPSTGDATEWRNPHLSMLGSCQPAPSCQKCILSHPSCAWCKQLNFT      1 - 70
ASGEAEARRCARREELLARGCPLEELEEPRGQQEVLQDQPLSQGARGEGATQLAPQRVRVTLRPGEPQQL     71 - 140
QVRFLRAEGYPVDLYYLMDLSYSMKDDLERVRQLGHALLVRLQEVTHSVRIGFGSFVDKTVLPFVSTVPS    141 - 210
KLRHPCPTRLERCQSPFSFHHVLSLTGDAQAFEREVGRQSVSGNLDSPEGGFDAILQAALCQEQIGWRNV    211 - 280
SRLLVFTSDDTFHTAGDGKLGGIFMPSDGHCHLDSNGLYSRSTEFDYPSVGQVAQALSAANIQPIFAVTS    281 - 350
AALPVYQELSKLIPKSAVGELSEDSSNVVQLIMDAYNSLSSTVTLEHSSLPPGVHISYESQCEGPEKREG    351 - 420
KAEDRGQCNHVRINQTVTFWVSLQATHCLPEPHLLRLRALGFSEELIVELHTLCDCNCSDTQPQAPHCSD    421 - 490
GQGHLQCGVCSCAPGRLGRLCECSVAELSSPDLESGCRAPNGTGPLCSGKGHCQCGRCSCSGQSSGHLCE    491 - 560
CDDASCERHEGILCGGFGRCQCGVCHCHANRTGRACECSGDMDSCISPEGGLCSGHGRCKCNRCQCLDGY    561 - 630
YGALCDQCPGCKTPCERHRDCAECGAFRTGPLATNCSTACAHTNVTLALAPILDDGWCKERTLDNQLFFF    631 - 700
LVEDDARGTVVLRVRPQEKGADHTQAIVLGCVGGIVAVGLGLVLAYRLSVEIYDRREYSRFEKEQQQLNW    701 - 770
KQDSNPLYKSAITTTINPRFQEADSPTL                                              771 - 798
//

Text Mined References (69)

PMID Year Title
26348893 2015 Differential Effects of Gut-Homing Molecules CC Chemokine Receptor 9 and Integrin-?7 during Acute Graft-versus-Host Disease of the Liver.
26105197 2015 South African HIV-1 subtype C transmitted variants with a specific V2 motif show higher dependence on ?4?7 for replication.
25008916 2014 Envelope glycoprotein binding to the integrin ?4?7 is not a general property of most HIV-1 strains.
24829201 2014 Trisomy 12 chronic lymphocytic leukemia cells exhibit upregulation of integrin signaling that is modulated by NOTCH1 mutations.
24802248 2014 The hydrophobic contacts between the center of the ?I domain and the ?1/?7 helices are crucial for the low-affinity state of integrin ?4 ?7.
24606696 2014 Circulating human rotavirus specific CD4 T cells identified with a class II tetramer express the intestinal homing receptors ?4?7 and CCR9.
24162774 2013 The HIV-1 envelope protein gp120 impairs B cell proliferation by inducing TGF-?1 production and FcRL4 expression.
23986478 2013 Disruption of disulfide restriction at integrin knees induces activation and ligand-independent signaling of ????.
23553626 2013 The unique disulfide bond-stabilized W1 ?4-?1 loop in the ?4 ?-propeller domain regulates integrin ?4?7 affinity and signaling.
23382219 2013 Structural basis for endosomal trafficking of diverse transmembrane cargos by PX-FERM proteins.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
22822002 2012 The ?4?7 integrin binds HIV envelope but does not mediate bystander killing of ?? T cells.
22418441 2012 Identification, characterization, and epitope mapping of human monoclonal antibody J19 that specifically recognizes activated integrin ?4?7.
22232704 2012 Structural specializations of ?(4)?(7), an integrin that mediates rolling adhesion.
21926999 2011 Mechanical strain in actin networks regulates FilGAP and integrin binding to filamin A.
21524097 2011 Evidence for multisite ligand binding and stretching of filamin by integrin and migfilin.
21474670 2011 Integrin ?7-mediated regulation of multiple myeloma cell adhesion, migration, and invasion.
21430257 2011 An integrin alpha4beta7•IgG heterodimeric chimera binds to MAdCAM-1 on high endothelial venules in gut-associated lymphoid tissue.
21398606 2011 Memory CCR6+CD4+ T cells are preferential targets for productive HIV type 1 infection regardless of their expression of integrin ?7.
21357540 2011 ?1 integrin is critical for the maintenance of antigen-specific CD4 T cells in the bone marrow but not long-term immunological memory.
21296888 2011 The CC' and DE loops in Ig domains 1 and 2 of MAdCAM-1 play different roles in MAdCAM-1 binding to low- and high-affinity integrin alpha4beta7.
21075690 2011 Development of gut-homing receptors on circulating B cells during infancy.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
19946888 2010 Defining the membrane proteome of NK cells.
19933330 2009 The integrin alpha4beta7 forms a complex with cell-surface CD4 and defines a T-cell subset that is highly susceptible to infection by HIV-1.
19828450 2009 Identification and characterization of multiple similar ligand-binding repeats in filamin: implication on filamin-mediated receptor clustering and cross-talk.
19699211 2009 The regulation mechanism for the auto-inhibition of binding of human filamin A to integrin.
18829455 2008 Structural basis of the migfilin-filamin interaction and competition with integrin beta tails.
18308860 2008 CCL25 and CCL28 promote alpha4 beta7-integrin-dependent adhesion of lymphocytes to MAdCAM-1 under shear flow.
18264102 2008 HIV-1 envelope protein binds to and signals through integrin alpha4beta7, the gut mucosal homing receptor for peripheral T cells.
17690686 2007 Structure of three tandem filamin domains reveals auto-inhibition of ligand binding.
17490615 2007 AhR- and c-maf-dependent induction of beta7-integrin expression in human macrophages in response to environmental polycyclic aromatic hydrocarbons.
17325197 2007 Alpha E beta 7 integrin interaction with E-cadherin promotes antitumor CTL activity by triggering lytic granule polarization and exocytosis.
16874740 2006 A pseudosymmetric cell adhesion regulatory domain in the beta7 tail of the integrin alpha4beta7 that interacts with focal adhesion kinase and src.
16818733 2006 Clustering of pre-B cell integrins induces galectin-1-dependent pre-B cell receptor relocalization and activation.
16455489 2006 The molecular basis of filamin binding to integrins and competition with talin.
16177076 2005 Alpha E beta 7 (CD103) expression identifies a highly active, tonsil-resident effector-memory CTL population.
15749880 2005 VH1-46 is the dominant immunoglobulin heavy chain gene segment in rotavirus-specific memory B cells expressing the intestinal homing receptor alpha4beta7.
15699171 2005 L-selectin, alpha 4 beta 1, and alpha 4 beta 7 integrins participate in CD4+ T cell recruitment to chronically inflamed small intestine.
15663557 2004 Single nucleotide polymorphism screening and association analysis--exclusion of integrin beta 7 and vitamin D receptor (chromosome 12q) as candidate genes for asthma.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15448154 2004 The relative influence of metal ion binding sites in the I-like domain and the interface with the hybrid domain on rolling and firm adhesion by integrin alpha4beta7.
15225631 2004 Interaction of filamin A with the integrin beta 7 cytoplasmic domain: role of alternative splicing and phosphorylation.
14681217 2004 Involvement of transmembrane domain interactions in signal transduction by alpha/beta integrins.
14608374 2003 Bistable regulation of integrin adhesiveness by a bipolar metal ion cluster.
12840763 2003 Selective imprinting of gut-homing T cells by Peyer's patch dendritic cells.
12682249 2003 Threonine phosphorylation sites in the beta 2 and beta 7 leukocyte integrin polypeptides.
12606711 2003 Integrin beta cytoplasmic domain interactions with phosphotyrosine-binding domains: a structural prototype for diversity in integrin signaling.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12297042 2002 Integrins: bidirectional, allosteric signaling machines.
11781567 2001 Increased filamin binding to beta-integrin cytoplasmic domains inhibits cell migration.
11160270 2001 The microenvironment of human Peyer's patches inhibits the increase in CD38 expression associated with the germinal center reaction.
11035069 2000 Maturation-dependent expression and function of the CD49d integrin on monocyte-derived human dendritic cells.
10837471 2000 The role of alpha and beta chains in ligand recognition by beta 7 integrins.
10790430 2000 Molecular basis for leukocyte integrin alpha(E)beta(7) adhesion to epithelial (E)-cadherin.
9765275 1998 The human WD repeat protein WAIT-1 specifically interacts with the cytoplasmic tails of beta7-integrins.
9655832 1998 The structure of immunoglobulin superfamily domains 1 and 2 of MAdCAM-1 reveals novel features important for integrin recognition.
9233649 1997 Structure-function analysis of the integrin beta 7 subunit: identification of domains involved in adhesion to MAdCAM-1.
8119947 1994 Molecular cloning of the human mucosal lymphocyte integrin alpha E subunit. Unusual structure and restricted RNA distribution.
7689608 1993 Alpha 4 beta 7 integrin mediates B cell binding to fibronectin and vascular cell adhesion molecule-1. Expression and function of alpha 4 integrins on human B lymphocytes.
7509610 1994 Lung epithelial lining fluid T cell subsets defined by distinct patterns of beta 7 and beta 1 integrin expression.
2083230 1990 Cloning and sequence analysis of a novel beta 2-related integrin transcript from T lymphocytes: homology of integrin cysteine-rich repeats to domain III of laminin B chains.
2040616 1991 Complete amino acid sequence of an integrin beta subunit (beta 7) identified in leukocytes.
1777426 1991 Cloning and sequence analysis of a novel beta 2-related integrin transcript from T lymphocytes: homology of integrin cysteine-rich repeats to domain III of laminin B chains.
1750505 1991 HML-1 antigen on mucosa-associated T cells, activated cells, and hairy leukemic cells is a new integrin containing the beta 7 subunit.
1543919 1992 Mapping of the human integrin beta 7 gene (ITG beta 7) to 12q13.13 by non-isotopic in situ hybridization.
1542691 1992 A family of beta 7 integrins on human mucosal lymphocytes.
1382574 1992 The gene organization of the human beta 7 subunit, the common beta subunit of the leukocyte integrins HML-1 and LPAM-1.
1372909 1992 Role of integrin alpha 4 beta 7/alpha 4 beta P in lymphocyte adherence to fibronectin and VCAM-1 and in homotypic cell clustering.