Property Summary

NCBI Gene PubMed Count 28
PubMed Score 14.77
PubTator Score 17.36

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count
Endometriosis 535
Disease Target Count Z-score Confidence
Omphalocele 22 3.448 1.7

Expression

  Differential Expression (8)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.632 2.6e-03
Multiple myeloma 1.462 3.5e-03
glioblastoma multiforme 1.300 2.1e-20
osteosarcoma -1.326 9.2e-03
group 3 medulloblastoma 1.700 8.5e-05
medulloblastoma, large-cell 1.200 5.9e-04
lung cancer 1.400 3.5e-04
pituitary cancer 1.100 2.9e-04

Protein-protein Interaction (5)

Gene RIF (8)

PMID Text
24386901 The beta3-endonexin can act as a novel anti-angiogenic factor specifically in the response to hypoxia due to its negative impact on the activation of HIF-1.
23028590 Data propose that CENP-P/O/R/Q/U self-assembles on kinetochores with varying stoichiometry and undergoes a pre-mitotic maturation step that could be important for kinetochores switching into the correct conformation for microtubule-attachment.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18521086 findings suggest that NRIF3-Ser28 is a physiologic target of Pak1 signaling and contributes to the enhanced NRIF3 co-activator activity, leading to coordinated potentiation of ERalpha transactivation
15254226 Metastasis-associated protein 1 interacts with NRIF3, an estrogen-inducible nuclear receptor coregulator
15082778 Results suggest that breast cancer cells contain a novel "death switch" that can be specifically triggered by NRIF3 or death domain 1.
12244126 This protein downregulates urokinase-type plasminogen activator receptor promoter activity.
11864709 The presence of various isoforms and the relationship between subcellular localization and integrin-activating function of beta(3)-endonexin is described.

AA Sequence

MPVKRSLKLDGLLEENSFDPSKITRKKSVITYSPTTGTCQMSLFASPTSSEEQKHRNGLSNEKRKKLNHP      1 - 70
SLTESKESTTKDNDEFMMLLSKVEKLSEEIMEIMQNLSSIQALEGSRELENLIGISCASHFLKREMQKTK     71 - 140
ELMTKVNKQKLFEKSTGLPHKASRHLDSYEFLKAILN                                     141 - 177
//

Text Mined References (32)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24386901 2014 The ?3-integrin binding protein ?3-endonexin is a novel negative regulator of hypoxia-inducible factor-1.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23028590 2012 Step-wise assembly, maturation and dynamic behavior of the human CENP-P/O/R/Q/U kinetochore sub-complex.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18521086 2008 Serine 28 phosphorylation of NRIF3 confers its co-activator function for estrogen receptor-alpha transactivation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16630834 2006 Ligand-dependent cleavage of the P75 neurotrophin receptor is necessary for NRIF nuclear translocation and apoptosis in sympathetic neurons.
16622420 2006 The CENP-H-I complex is required for the efficient incorporation of newly synthesized CENP-A into centromeres.
16622419 2006 The human CENP-A centromeric nucleosome-associated complex.
16252010 2005 TRAF6-mediated ubiquitination regulates nuclear translocation of NRIF, the p75 receptor interactor.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15721744 2005 p75NTR--live or let die.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15254226 2004 Metastasis-associated protein 1 interacts with NRIF3, an estrogen-inducible nuclear receptor coregulator.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
15082778 2004 The NRIF3 family of transcriptional coregulators induces rapid and profound apoptosis in breast cancer cells.
14960584 2004 A functional interaction between the p75 neurotrophin receptor interacting factors, TRAF6 and NRIF.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12787561 Ten years on: mediation of cell death by the common neurotrophin receptor p75(NTR).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12244126 2002 Role of beta(3)-endonexin in the regulation of NF-kappaB-dependent expression of urokinase-type plasminogen activator receptor.
11864709 2002 Novel alternatively spliced form of beta(3)-endonexin.
11713274 2001 Domain structure of the NRIF3 family of coregulators suggests potential dual roles in transcriptional regulation.
10673397 2000 beta3-endonexin as a novel inhibitor of cyclin A-associated kinase.
10579726 1999 Enhancement of endothelial cell migration and in vitro tube formation by TAP20, a novel beta 5 integrin-modulating, PKC theta-dependent protein.
10490654 1999 NRIF3 is a novel coactivator mediating functional specificity of nuclear hormone receptors.
9182673 1997 Affinity modulation of platelet integrin alphaIIbbeta3 by beta3-endonexin, a selective binding partner of the beta3 integrin cytoplasmic tail.
7593198 1995 Beta 3-endonexin, a novel polypeptide that interacts specifically with the cytoplasmic tail of the integrin beta 3 subunit.