Property Summary

Ligand Count 1
NCBI Gene PubMed Count 442
PubMed Score 232.11
PubTator Score 1246.23

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count
Tear film insufficiency 15
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Disease Target Count Z-score Confidence
Leukocyte adhesion deficiency 16 6.49 3.2

Expression

  Differential Expression (30)

Disease log2 FC p
acute myeloid leukemia 1.200 2.9e-02
adult high grade glioma 1.400 9.7e-03
astrocytoma 3.100 1.6e-03
Astrocytoma, Pilocytic 1.800 7.0e-09
Breast cancer 1.200 1.5e-02
breast carcinoma 1.900 1.1e-03
Chronic Lymphocytic Leukemia -2.022 5.7e-05
cutaneous lupus erythematosus 1.500 2.7e-03
dermatomyositis 1.200 1.0e-02
Down syndrome 1.500 2.5e-03
Duchenne muscular dystrophy 1.201 2.4e-09
ependymoma 1.100 4.7e-04
gastric carcinoma 1.800 3.1e-02
glioblastoma 1.400 9.6e-04
head and neck cancer -1.100 1.3e-02
head and neck cancer and chronic obstruc... 1.200 2.4e-03
interstitial cystitis 2.000 2.5e-03
intraductal papillary-mucinous adenoma (... -1.300 1.1e-02
intraductal papillary-mucinous carcinoma... -1.300 1.6e-02
invasive ductal carcinoma 1.665 2.3e-04
lung cancer -1.700 4.2e-04
lung carcinoma -2.300 3.4e-25
malignant mesothelioma 2.500 3.8e-08
medulloblastoma, large-cell -1.500 3.6e-03
osteosarcoma -2.489 8.6e-03
ovarian cancer -1.500 2.4e-03
primary Sjogren syndrome 1.700 3.0e-04
subependymal giant cell astrocytoma 1.965 2.1e-02
tuberculosis 1.600 3.0e-07
ulcerative colitis 1.800 1.5e-05

Protein-protein Interaction (12)

Gene RIF (367)

AA Sequence

MLGLRPPLLALVGLLSLGCVLSQECTKFKVSSCRECIESGPGCTWCQKLNFTGPGDPDSIRCDTRPQLLM      1 - 70
RGCAADDIMDPTSLAETQEDHNGGQKQLSPQKVTLYLRPGQAAAFNVTFRRAKGYPIDLYYLMDLSYSML     71 - 140
DDLRNVKKLGGDLLRALNEITESGRIGFGSFVDKTVLPFVNTHPDKLRNPCPNKEKECQPPFAFRHVLKL    141 - 210
TNNSNQFQTEVGKQLISGNLDAPEGGLDAMMQVAACPEEIGWRNVTRLLVFATDDGFHFAGDGKLGAILT    211 - 280
PNDGRCHLEDNLYKRSNEFDYPSVGQLAHKLAENNIQPIFAVTSRMVKTYEKLTEIIPKSAVGELSEDSS    281 - 350
NVVQLIKNAYNKLSSRVFLDHNALPDTLKVTYDSFCSNGVTHRNQPRGDCDGVQINVPITFQVKVTATEC    351 - 420
IQEQSFVIRALGFTDIVTVQVLPQCECRCRDQSRDRSLCHGKGFLECGICRCDTGYIGKNCECQTQGRSS    421 - 490
QELEGSCRKDNNSIICSGLGDCVCGQCLCHTSDVPGKLIYGQYCECDTINCERYNGQVCGGPGRGLCFCG    491 - 560
KCRCHPGFEGSACQCERTTEGCLNPRRVECSGRGRCRCNVCECHSGYQLPLCQECPGCPSPCGKYISCAE    561 - 630
CLKFEKGPFGKNCSAACPGLQLSNNPVKGRTCKERDSEGCWVAYTLEQQDGMDRYLIYVDESRECVAGPN    631 - 700
IAAIVGGTVAGIVLIGILLLVIWKALIHLSDLREYRRFEKEKLKSQWNNDNPLFKSATTTVMNPKFAES     701 - 769
//

Text Mined References (450)

PMID Year Title