Property Summary

Ligand Count 1
NCBI Gene PubMed Count 1,079
PubMed Score 1269.76
PubTator Score 1599.89

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Expression

  Differential Expression (14)

Disease log2 FC p
Astrocytoma, Pilocytic 1.400 2.4e-07
atypical teratoid / rhabdoid tumor 1.400 6.9e-07
dermatomyositis 1.100 6.2e-03
Down syndrome 1.100 4.7e-03
ependymoma 1.100 9.1e-09
glioblastoma 1.200 1.2e-06
lung adenocarcinoma -1.300 1.9e-06
medulloblastoma 1.100 4.6e-05
osteosarcoma 2.003 3.7e-06
pancreatic cancer 1.200 1.0e-03
pediatric high grade glioma 1.500 2.3e-06
primary pancreatic ductal adenocarcinoma 1.146 1.1e-03
primitive neuroectodermal tumor 1.100 2.1e-04
subependymal giant cell astrocytoma 1.842 2.0e-02

Synonym

Accession P05556 A8K6N2 D3DRX9 D3DRY3 D3DRY4 D3DRY5 P78466 P78467 Q13089 Q13090 Q13091 Q13212 Q14622 Q14647 Q29RW2 Q7Z3V1 Q8WUM6
Symbols CD29
FNRB
MDF2
VLAB
GPIIA
MSK12
VLA-BETA

Gene

Protein-protein Interaction (11)

PDB (11)

Gene RIF (881)

AA Sequence

MNLQPIFWIGLISSVCCVFAQTDENRCLKANAKSCGECIQAGPNCGWCTNSTFLQEGMPTSARCDDLEAL      1 - 70
KKKGCPPDDIENPRGSKDIKKNKNVTNRSKGTAEKLKPEDITQIQPQQLVLRLRSGEPQTFTLKFKRAED     71 - 140
YPIDLYYLMDLSYSMKDDLENVKSLGTDLMNEMRRITSDFRIGFGSFVEKTVMPYISTTPAKLRNPCTSE    141 - 210
QNCTSPFSYKNVLSLTNKGEVFNELVGKQRISGNLDSPEGGFDAIMQVAVCGSLIGWRNVTRLLVFSTDA    211 - 280
GFHFAGDGKLGGIVLPNDGQCHLENNMYTMSHYYDYPSIAHLVQKLSENNIQTIFAVTEEFQPVYKELKN    281 - 350
LIPKSAVGTLSANSSNVIQLIIDAYNSLSSEVILENGKLSEGVTISYKSYCKNGVNGTGENGRKCSNISI    351 - 420
GDEVQFEISITSNKCPKKDSDSFKIRPLGFTEEVEVILQYICECECQSEGIPESPKCHEGNGTFECGACR    421 - 490
CNEGRVGRHCECSTDEVNSEDMDAYCRKENSSEICSNNGECVCGQCVCRKRDNTNEIYSGKFCECDNFNC    491 - 560
DRSNGLICGGNGVCKCRVCECNPNYTGSACDCSLDTSTCEASNGQICNGRGICECGVCKCTDPKFQGQTC    561 - 630
EMCQTCLGVCAEHKECVQCRAFNKGEKKDTCTQECSYFNITKVESRDKLPQPVQPDPVSHCKEKDVDDCW    631 - 700
FYFTYSVNGNNEVMVHVVENPECPTGPDIIPIVAGVVAGIVLIGLALLLIWKLLMIIHDRREFAKFEKEK    701 - 770
MNAKWDTGENPIYKSAVTTVVNPKYEGK                                              771 - 798
//

Text Mined References (1103)

PMID Year Title