Property Summary

Ligand Count 35
NCBI Gene PubMed Count 522
PubMed Score 407.19
PubTator Score 468.15

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
acute quadriplegic myopathy 1.030 1.2e-04
Astrocytoma, Pilocytic 1.400 1.5e-06
Breast cancer 2.500 2.9e-02
diabetes mellitus -1.100 4.8e-03
glioblastoma 1.100 2.9e-02
group 3 medulloblastoma -1.100 4.5e-02
hereditary spastic paraplegia -1.161 3.0e-03
medulloblastoma, large-cell -2.200 2.8e-04
nasopharyngeal carcinoma 1.100 1.8e-03
non-small cell lung cancer 1.006 5.0e-12
osteosarcoma 2.002 2.8e-03
ovarian cancer -1.800 9.7e-04
Rheumatoid arthritis 1.200 3.8e-02
tuberculosis -2.600 2.8e-08

Protein-protein Interaction (3)

Gene RIF (423)

AA Sequence

MAFPPRRRLRLGPRGLPLLLSGLLLPLCRAFNLDVDSPAEYSGPEGSYFGFAVDFFVPSASSRMFLLVGA      1 - 70
PKANTTQPGIVEGGQVLKCDWSSTRRCQPIEFDATGNRDYAKDDPLEFKSHQWFGASVRSKQDKILACAP     71 - 140
LYHWRTEMKQEREPVGTCFLQDGTKTVEYAPCRSQDIDADGQGFCQGGFSIDFTKADRVLLGGPGSFYWQ    141 - 210
GQLISDQVAEIVSKYDPNVYSIKYNNQLATRTAQAIFDDSYLGYSVAVGDFNGDGIDDFVSGVPRAARTL    211 - 280
GMVYIYDGKNMSSLYNFTGEQMAAYFGFSVAATDINGDDYADVFIGAPLFMDRGSDGKLQEVGQVSVSLQ    281 - 350
RASGDFQTTKLNGFEVFARFGSAIAPLGDLDQDGFNDIAIAAPYGGEDKKGIVYIFNGRSTGLNAVPSQI    351 - 420
LEGQWAARSMPPSFGYSMKGATDIDKNGYPDLIVGAFGVDRAILYRARPVITVNAGLEVYPSILNQDNKT    421 - 490
CSLPGTALKVSCFNVRFCLKADGKGVLPRKLNFQVELLLDKLKQKGAIRRALFLYSRSPSHSKNMTISRG    491 - 560
GLMQCEELIAYLRDESEFRDKLTPITIFMEYRLDYRTAADTTGLQPILNQFTPANISRQAHILLDCGEDN    561 - 630
VCKPKLEVSVDSDQKKIYIGDDNPLTLIVKAQNQGEGAYEAELIVSIPLQADFIGVVRNNEALARLSCAF    631 - 700
KTENQTRQVVCDLGNPMKAGTQLLAGLRFSVHQQSEMDTSVKFDLQIQSSNLFDKVSPVVSHKVDLAVLA    701 - 770
AVEIRGVSSPDHVFLPIPNWEHKENPETEEDVGPVVQHIYELRNNGPSSFSKAMLHLQWPYKYNNNTLLY    771 - 840
ILHYDIDGPMNCTSDMEINPLRIKISSLQTTEKNDTVAGQGERDHLITKRDLALSEGDIHTLGCGVAQCL    841 - 910
KIVCQVGRLDRGKSAILYVKSLLWTETFMNKENQNHSYSLKSSASFNVIEFPYKNLPIEDITNSTLVTTN    911 - 980
VTWGIQPAPMPVPVWVIILAVLAGLLLLAVLVFVMYRMGFFKRVRPPQEEQEREQLQPHENGEGNSET      981 - 1048
//

Text Mined References (533)

PMID Year Title