Property Summary

NCBI Gene PubMed Count 49
PubMed Score 377.46
PubTator Score 130.29

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.237 1.8e-02
Multiple myeloma 1.064 3.4e-02
Pick disease -1.200 2.9e-04
ovarian cancer -1.900 6.4e-08

 IMPC Phenotype (1)

 CSPA Cell Line (1)

Protein-protein Interaction (1)

Gene RIF (33)

PMID Text
26813744 detected CD103 tumor cells in 41% (16/39) of lymph node-involved adult T-cell leukemia/lymphoma
26522261 Levels of GZMA and ITGAE mRNAs in colon tissues can identify patients with UC who are most likely to benefit from etrolizumab; expression levels decrease with etrolizumab administration in biomarker(high) patients.
25957117 PD-1(+)CD103(+) CD8 TIL might regain functional antitumor activity, an effect that potentially could be augmented by immune modulation.
25637255 This report highlights the diagnostic difficulties and the need of consensus in categorizing clonal CD103(+) lymphocytosis in patients with refractory celiac disease.
25584868 Cell-sorting experiments demonstrated that IDO1 expression is found in a subset of CD1a(+)CD14(-)langerin(+) cells, expressing CD103
25025448 Report CD103 expression occurs most frequently in gastrointestinal T-cell lymphomas.
24477908 Using a human CTL system model based on a CD8(+)/CD103(-) T cell clone specific of a lung tumor-associated Ag, we demonstrated that the transcription factors Smad2/3 and NFAT-1 are two critical regulators of this process.
24190978 Tumor-infiltrating lymphocytes expressing the tissue resident memory marker CD103 are associated with increased survival in high-grade serous ovarian cancer.
22922816 Memory CD103+ CD8 T cells that persist within the brain after an acute infection with vesicular stomatitis virus are bona fide tissue resident memory cells.
21948982 Lymphoid tissue (LT)-resident CD8alpha-positive dendritic cells (DCs) and non(LT)-derived CD103-positive DCs express transgenic XCR1 and are characterized by a unique transcriptional fingerprint, irrespective of their tissue of origin.
21917686 These findings support the usefulness of CD123 and CD103 to aid in the differential diagnosis of B-cell lymphoproliferative disorders
21739671 Studies indicate that the mechanisms that regulate the retention of tissue-resident memory T cells include TGF-beta-mediated induction of CD103 and downregulation of CCR7.
20875079 results show that binding of the human alphaE I domain to oral and skin keratinocytes is independent of E-cadherin
20588308 Observational study of gene-disease association. (HuGE Navigator)
20417566 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
19604725 A higher proportion of CD103+CD4+ T cells and ITGAE -1088 AA genotype might be associated with fibrosis formation in pulmonary sarcoidosis.
19604725 Observational study of gene-disease association. (HuGE Navigator)
19150377 Phenotypic analysis of peripheral blood and decidual CD8+ T cells showed the presence of activated CD8+ T cells as well as a population of CD8+CD103+ T cells in decidual tissue
19074885 Observational study of gene-disease association. (HuGE Navigator)
19023099 Observational study of gene-disease association. (HuGE Navigator)
18492951 integrin alpha(E)(CD103)beta(7) is not only involved in epithelial retention, but also in shaping and proper intraepithelial morphogenesis of some leukocytes.
18182176 An investigation to evaluate the diagnostic value of relative number of CD103 expressing CD4(+) T-lymphocytes in the BAL fluid of patients with a variety of interstitial lung diseases, including pulmonary sarcoidosis, is reported.
17975119 Observational study of gene-disease association. (HuGE Navigator)
17325197 CD8+/CD103+ tumor-reactive T lymphocytes infiltrating epithelial tumors most likely play a major role in antitumor cytotoxic response through alphaEbeta7-E-cadherin interactions.
16920912 human alloantigen-induced CD103+ CD8+ T cells possess functional features of regulatory T cells
16216886 CD103 expression on dendritic cells influences the balance between effector and regulatory T cell activity in the intestine.
16177076 Integrin/activation marker CD103 (alphaEbeta7) is expressed on Epstein-Barr virus-specific tonsil-resident (but not peripheral blood mononuclear leukocyte-derived) cytotoxic T lymphocytes.
15196058 CD103 promotes destruction of renal allografts by CD8 T cells
14532999 Differential up-regulation of CD103 expression on lamina propria lymphocytes in Crohn's disease may indicate differential humoral or cellular regulation in inducing CD103 molecules on lymphocytes in patients with this disease
12414996 Involvement of the adhesive ligand pair CD103-E-cadherin in human thymocyte cell proliferation
12370249 has a role in mucosal immunity and graft rejection

AA Sequence

MWLFHTLLCIASLALLAAFNVDVARPWLTPKGGAPFVLSSLLHQDPSTNQTWLLVTSPRTKRTPGPLHRC      1 - 70
SLVQDEILCHPVEHVPIPKGRHRGVTVVRSHHGVLICIQVLVRRPHSLSSELTGTCSLLGPDLRPQAQAN     71 - 140
FFDLENLLDPDARVDTGDCYSNKEGGGEDDVNTARQRRALEKEEEEDKEEEEDEEEEEAGTEIAIILDGS    141 - 210
GSIDPPDFQRAKDFISNMMRNFYEKCFECNFALVQYGGVIQTEFDLRDSQDVMASLARVQNITQVGSVTK    211 - 280
TASAMQHVLDSIFTSSHGSRRKASKVMVVLTDGGIFEDPLNLTTVINSPKMQGVERFAIGVGEEFKSART    281 - 350
ARELNLIASDPDETHAFKVTNYMALDGLLSKLRYNIISMEGTVGDALHYQLAQIGFSAQILDERQVLLGA    351 - 420
VGAFDWSGGALLYDTRSRRGRFLNQTAAAAADAEAAQYSYLGYAVAVLHKTCSLSYIAGAPRYKHHGAVF    421 - 490
ELQKEGREASFLPVLEGEQMGSYFGSELCPVDIDMDGSTDFLLVAAPFYHVHGEEGRVYVYRLSEQDGSF    491 - 560
SLARILSGHPGFTNARFGFAMAAMGDLSQDKLTDVAIGAPLEGFGADDGASFGSVYIYNGHWDGLSASPS    561 - 630
QRIRASTVAPGLQYFGMSMAGGFDISGDGLADITVGTLGQAVVFRSRPVVRLKVSMAFTPSALPIGFNGV    631 - 700
VNVRLCFEISSVTTASESGLREALLNFTLDVDVGKQRRRLQCSDVRSCLGCLREWSSGSQLCEDLLLMPT    701 - 770
EGELCEEDCFSNASVKVSYQLQTPEGQTDHPQPILDRYTEPFAIFQLPYEKACKNKLFCVAELQLATTVS    771 - 840
QQELVVGLTKELTLNINLTNSGEDSYMTSMALNYPRNLQLKRMQKPPSPNIQCDDPQPVASVLIMNCRIG    841 - 910
HPVLKRSSAHVSVVWQLEENAFPNRTADITVTVTNSNERRSLANETHTLQFRHGFVAVLSKPSIMYVNTG    911 - 980
QGLSHHKEFLFHVHGENLFGAEYQLQICVPTKLRGLQVVAVKKLTRTQASTVCTWSQERACAYSSVQHVE    981 - 1050
EWHSVSCVIASDKENVTVAAEISWDHSEELLKDVTELQILGEISFNKSLYEGLNAENHRTKITVVFLKDE   1051 - 1120
KYHSLPIIIKGSVGGLLVLIVILVILFKCGFFKRKYQQLNLESIRKAQLKSENLLEEEN              1121 - 1179
//

Text Mined References (50)

PMID Year Title
26813744 2016 High Expression of Intestinal Homing Receptor CD103 in Adult T-Cell Leukemia/Lymphoma, Similar to 2 Other CD8+ T-Cell Lymphomas.
26522261 2016 Association Between Response to Etrolizumab and Expression of Integrin ?E and Granzyme A in Colon Biopsies of Patients With Ulcerative Colitis.
25957117 2015 PD-1 and CD103 Are Widely Coexpressed on Prognostically Favorable Intraepithelial CD8 T Cells in Human Ovarian Cancer.
25637255 2015 CD103+ ?? T cell large granular lymphocytosis in a patient with refractory celiac disease: a diagnostic enigma.
25584868 2015 CD103 marks a subset of human CD34+-derived langerin+ dendritic cells that induce T-regulatory cells via indoleamine 2,3-dioxygenase-1.
25025448 2014 Profile of CD103 expression in T-cell neoplasms: immunoreactivity is not restricted to enteropathy-associated T-cell lymphoma.
24477908 2014 Smad and NFAT pathways cooperate to induce CD103 expression in human CD8 T lymphocytes.
24190978 2014 Tumor-infiltrating lymphocytes expressing the tissue resident memory marker CD103 are associated with increased survival in high-grade serous ovarian cancer.
22922816 2012 The molecular signature of tissue resident memory CD8 T cells isolated from the brain.
21948982 2011 Cutting edge: expression of XCR1 defines mouse lymphoid-tissue resident and migratory dendritic cells of the CD8?+ type.
21917686 2011 Characteristic CD103 and CD123 expression pattern defines hairy cell leukemia: usefulness of CD123 and CD103 in the diagnosis of mature B-cell lymphoproliferative disorders.
21739671 2011 Regional and mucosal memory T cells.
20875079 2011 The ?E(CD103)?7 integrin interacts with oral and skin keratinocytes in an E-cadherin-independent manner*.
20588308 2010 Dengue hemorrhagic fever is associated with polymorphisms in JAK1.
20417566 2010 Disease association of the CD103 polymorphisms in Taiwan Chinese Graves' ophthalmopathy patients.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
19604725 2009 Effect of variation in ITGAE on risk of sarcoidosis, CD103 expression, and chest radiography.
19150377 2009 Decidual CD8+CD28- T cells express CD103 but not perforin.
19074885 2008 Genetic variants in apoptosis and immunoregulation-related genes are associated with risk of chronic lymphocytic leukemia.
19023099 2009 Gene variants associated with ischemic stroke: the cardiovascular health study.
18839057 2008 Molecular genetics of adult ADHD: converging evidence from genome-wide association and extended pedigree linkage studies.
18492951 2008 Integrin alpha E(CD103)beta 7 influences cellular shape and motility in a ligand-dependent fashion.
18182176 2008 Evaluation of CD103 as a cellular marker for the diagnosis of pulmonary sarcoidosis.
17975119 2008 Association of gene variants with incident myocardial infarction in the Cardiovascular Health Study.
17325197 2007 Alpha E beta 7 integrin interaction with E-cadherin promotes antitumor CTL activity by triggering lytic granule polarization and exocytosis.
16920912 2006 CD103 is a marker for alloantigen-induced regulatory CD8+ T cells.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
16216886 2005 Essential role for CD103 in the T cell-mediated regulation of experimental colitis.
16177076 2005 Alpha E beta 7 (CD103) expression identifies a highly active, tonsil-resident effector-memory CTL population.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15196058 2004 Role of integrin CD103 in promoting destruction of renal allografts by CD8 T cells.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14532999 2003 Differential expression of homing receptor CD103 on lamina propria lymphocytes and association of CD103 with epithelial adhesion molecules in inflammatory bowel disease.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12414996 2002 E-cadherin-mediated interactions of thymic epithelial cells with CD103+ thymocytes lead to enhanced thymocyte cell proliferation.
12370249 2002 Alpha E: no more rejection?
11311556 2001 The Haspin gene: location in an intron of the integrin alphaE gene, associated transcription of an integrin alphaE-derived RNA and expression in diploid as well as haploid cells.
10978890 2000 T-lymphocyte-epithelial-cell interactions: integrin alpha(E)(CD103)beta(7), LEEP-CAM and chemokines.
10837471 2000 The role of alpha and beta chains in ligand recognition by beta 7 integrins.
10790430 2000 Molecular basis for leukocyte integrin alpha(E)beta(7) adhesion to epithelial (E)-cadherin.
10673275 2000 The genomic region encompassing the nephropathic cystinosis gene (CTNS): complete sequencing of a 200-kb segment and discovery of a novel gene within the common cystinosis-causing deletion.
9765275 1998 The human WD repeat protein WAIT-1 specifically interacts with the cytoplasmic tails of beta7-integrins.
9676575 1998 Ligand recognition by the I domain-containing integrins.
8580465 1995 The beta 7 integrins in mucosal homing and retention.
8526015 1995 HML-1, a novel integrin made of the beta 7 chain and of a distinctive alpha chain, exerts an accessory function in the activation of human IEL via the CD3-TCR pathway.
8119947 1994 Molecular cloning of the human mucosal lymphocyte integrin alpha E subunit. Unusual structure and restricted RNA distribution.
7614974 1995 Transforming growth factor-beta 1-induced expression of the mucosa-related integrin alpha E on lymphocytes is not associated with mucosa-specific homing.
3498635 1987 A monoclonal antibody (HML-1) defining a novel membrane molecule present on human intestinal lymphocytes.
1542691 1992 A family of beta 7 integrins on human mucosal lymphocytes.