Property Summary

NCBI Gene PubMed Count 302
PubMed Score 159.62
PubTator Score 260.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
malignant mesothelioma -1.400 6.5e-07
psoriasis -1.900 2.4e-04
osteosarcoma -1.184 1.8e-03
glioblastoma 2.000 9.4e-04
tuberculosis -1.900 1.6e-08
primary pancreatic ductal adenocarcinoma 1.354 1.6e-02
colon cancer -1.300 5.7e-04
interstitial cystitis 1.300 9.3e-04
lung adenocarcinoma -1.100 4.1e-09
pediatric high grade glioma 1.500 1.6e-03
posterior fossa group A ependymoma 1.300 4.9e-05
subependymal giant cell astrocytoma 1.551 2.2e-02
inflammatory breast cancer 1.200 2.6e-03
lung carcinoma -2.300 4.2e-21
non-small cell lung carcinoma -1.200 2.0e-19
gastric carcinoma 2.000 2.0e-02
ulcerative colitis 1.300 2.3e-03

Protein-protein Interaction (2)

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
2628 confirmatory 0 / 0 / 2 Selectivity Counterscreen Cell Adhesion Assay for Inhibitors of Platelet Integrin alphallb-beta3

Gene RIF (241)

PMID Text
26900962 knockdown of PTTG1 increased expression of integrin alpha 4 (ITGA4), ITGA5, and integrin beta 1 (ITGB1); otherwise, RhoA expression was significantly decreased
26823759 ITGA5 plays an important role in maintaining and regulating the normal migration capacity of dental pulp stem cells.
26772401 integrin alpha5 might play important roles in the progression of esophageal squamous cell carcinoma
26733684 The present study has revealed an integrin- and membrane lipid raft-dependent mechanotransduction mechanism by which atheroprone flow causes endothelial dysfunction.
26674523 Genetic and Immunohistochemical Expression of Integrins ITGAV, ITGA6, and ITGA3 As Prognostic Factor for Colorectal Cancer
26648324 The aim of the present study was to characterize the roles of ITGalpha5 and ITGbeta1 in the proliferation and migration of vascular smooth muscle cells.
26578516 Data suggest that reduced ability of AnxA6-expressing cells to migrate is associated with decreased cell surface expression of integrins alphaVbeta3 and alpha5beta1.
26431475 Collagens considerably suppressed alpha5 gene expression in CECs, suggesting that during wound
26370503 Suggest alpha5beta1/Arp2/Arp3/FHOD3 pathway reprograms the actin cytoskeleton to promote invasive migration and local invasion in vivo.
26244551 Data suggest that the binding, but not the internalization of photoreceptor outer segments (POS) confers protective effects on retinal pigment epithelium (RPE) cells through the alphavbeta5 integrin/focal adhesion kinase (FAK)/PGC-1alpha pathway.
26159767 Data show that the fold changes of very late antigen 5 VLA-5 (integrin alpha-5 beta-1) in CD14+ monocytes were higher than those observed for THP-1 cells.
26139991 Integrin alphanubeta6-mediated MMP-9 secretion facilitates pericellular matrix degradation at high cell density, promoting invasive growth of colonic neoplasms.
26076738 IGFBP-2 enhances endothelial progenitor cell adhesion to HUVECs via Integrin alpha5beta1. The RGD motif in the IGFBP-2 C-domain is required for interaction with integrin alpha5beta1.
25955828 Data suggest that Entamoeba histolytica-macrophage contact triggers recruitment of alpha5beta1 integrin (ITGA5/ITGB1) and NLRP3 into intercellular junction, where ITGA5/ITGB1 undergoes activation by cysteine protease on parasite surface.
25824336 Data show that a small molecule inhibitor of the MYC transcription factor can be an effective anticancer agent when delivered using a integrin alphavbeta3 and VLA-4-targeted nanotherapy approach.
25735609 Integrin alpha5beta1 was expressed on ligamentum flavum fibroblasts.
25663698 alpha5beta1 and alphavbeta3 each mediate actin cytoskeletal remodeling in response to stiffening or cyclic stretching of the extracellular matrix.
25623744 we detected higher activity of AKT (p = 0.011) and FAK (p = 0.054), higher integrin alpha5 expression (p = 0.052) and lower PTEN expression in primary cells from patients with bone metastasis compared to nonmetastasizing cells.
25600770 Twist1 and AP-1 cooperatively upregulate integrin alpha5 expression to induce invasion and the epithelial-mesenchymal transition.Twist1 expression positively correlates with integrin alpha5 expression in human colorectal cancers.
25537511 Data indicate that alpha5 integrin (ITGA5) is a functional target of miroRNA miR-26a-induced anoikis in hepatocellular carcinoma (HCC) cells.
25378411 PAI-1 inhibits activation of VEGFR-2 by VEGF by disrupting a vitronectin-dependent proangiogenic binding interaction involving alphaVbeta3 and VEGFR-2
25339175 Data indicate that influenza A virus H1N1 infection activated alphavbeta6 integrin-dependent transforming growth factor beta (TGFbeta) activity in immortalized bronchial epithelial cells (iHBEC).
25313583 Alpha 5 integrin antibody 17E6 and alpha 5/beta 6 integrins inhibitor EMD 409849 inhibit HIV-1 infection of primary macrophages at an early stage of the virus cycle, suggesting the interaction of HIV-1 gp120 with alpha 5/beta 6 integrins
25242040 Mesodermal expression of integrin alpha5beta1 regulates neural crest development and cardiovascular morphogenesis.
25237190 angiopoietin-2 Gln362 mediates migration of tumor and endothelial cells through association with alpha5beta1 integrin
25216363 Dynamic catch of a Thy-1-integrin alpha5beta1+syndecan-4 trimolecular complex explains extraordinary cancer cell adhesion to the vascular endothelium.
25212537 Data indicate that no anti-tumor activity was observed in anti-alpha5beta1 integrin monoclonal antibody PF-04605412 treatment.
25174715 Synergy of uPAR mRNA and integrin alpha5beta1 interaction may result in abnormal signal transduction in liver cells and ultimately liver cell abnormal clonal hyperplasia and malignant transformation.
25092917 Results show that LOXL2 is highly expressed and involved in clear cell renal cell carcinoma progression by regulating the levels of integrins a5 and b1.
25062814 demonstrate that alpha5 integrin turnover is dependent on fibronectin matrix assembly
25058375 Data show that thyroid hormones induce mitogen-activated protein kinase (MAPK) via integrin alphavbeta3 in bone marrow-derived cells from multiple myeloma (MM).
24965773 When bound to Y. enterocolitica invasin, alpha5beta1 integrins on intestinal epithelial cells trigger interleukin (IL)-18 secretion through activation of the NLRP3 inflammasome.
24833794 Suggest that alpha5beta1-mediated cross-talk between fibronectin and oxLDL regulates inflammation in early atherogenesis and that therapeutics that inhibit alpha5 integrins may reduce inflammation without adversely affecting plaque structure.
24671180 In the presence of both 9-cis-retinoic acid and troglitazone, cell surface alpha5 subunit expression was restored to levels comparable to vehicle treatment alone.
24644284 Data indicate that alpha5beta1 integrin is recruited to lipid rafts through interactions with urokinase-type plasminogen activator receptor (uPAR).
24550382 The use of inhibitors to prevent their phosphorylation or ectopic overexpression of dominant-negative IkappaBalpha perturbed ET-1-induced integrin alphaV and integrin beta1 expression.
24478423 alpha5beta1 and alphav integrins are essential for cell-cell fusion and hMPV infection.
24464580 CCN2 and inflammatory cytokines form a functional negative feedback loop in NP cells involving interleukin-1beta through alpha5beta1 and alphaVbeta3 integrins that may be important in the pathogenesis of disc disease
24463276 phenotype of mice with alpha5-erythroid deletions was similar to controls, especially after stress. These outcomes seem to reconcile divergent prior views on the role of alpha5-integrin in erythropoiesis.
24448647 ANGPTL2 expression in OS cell lines correlated with increased tumor metastasis and decreased animal survival by promoting tumor cell intravasation mediated by the integrin alpha5beta1, p38 mitogen-activated protein kinase, and matrix metalloproteinases
24440971 Overexpression of integrin alpha v is closely associated with metastasis and progression of nasopharyngeal carcinoma.
24434435 We have demonstrated for the first time a new molecular pathway that connects TMPRSS4 and integrin alpha5 through miR-205 to regulate cancer cell invasion and metastasis
24312560 RhoC facilitates tumor cell invasion and promotes subsequent metastasis, in part, by enhancing integrin alpha5beta1 trafficking
24286194 Data indicate that in dedifferentiating chondrocytes, alpha5beta1 integrin was found to be involved in the induction of type I (COL1A1) and type III procollagen (COL3A1) expression.
24251463 Data show the molecular model of the complex of activated protein C (APC) with alphaVbeta3 integrin obtained by protein-protein docking approach.
24248895 The alpha5beta1-integrin promotes angiogenesis and associates with lymph node metastasis, vascular invasion and poor prognosis of gastric cancer
24182341 Integrin alpha5-FAK signaling pathway controls the proliferation of bladder smooth muscle cells in response to cyclic hydrodynamic pressure.
24176823 these results establish that GP IIb/IIIa and alphavbeta3 integrins are essential mediators of shear flow-induced cancer cell mechanotransduction
24109241 Herpes simplex virus gH/gL sufficed to elicit type I IFN and NF-kappaB activation via alphavbeta3 integrin in epithelial and neuronal cell lines.
24085800 High integrin alphaVbeta6 expression is associated with liver metastasis in colorectal cancer.
23967087 our results identify a novel regulatory pathway involving the interplay between ZO-1, alpha5-integrin and PKCepsilon in the late stages of mammalian cell division.
23886203 Integrin alpha5beta1 overexpression is associated with lymph node metastasis and vascular invasion in cervical cancer.
23819010 17-beta-estradiol modulates connexins and integrins as well as ER-beta expression induced by high frequency electromagnetic fields.
23770848 loss of BRM epigenetically induces C/EBPbeta transcription, which then directly induces alpha5 integrin transcription to promote the malignant behavior of mammary epithelial cells
23765377 We conclude that an OSMR/TGM2/integrin-alpha5beta1/fibronectin pathway is of biological significance in cervical squamous cell carcinoma
23686445 the identification of ITGA5 -E2/3 splice variant as potential novel adverse prognostic marker for low-risk AML
23664187 MIA protein is present in non-segmental vitiligo skin and may cause the detachment of melanocytes; its target is integrin alpha5beta1, which determines the breaking and/or weakening of connections among melanocytes and basal membrane
23640055 Data indicate that nuclear integrin alphav monomer in T4-exposed cells, but not integrin beta3, bound to promoters of specific genes that have important roles in cancer cells.
23640047 These findings support a direct role for Survivin in melanoma metastasis, which requires alpha5 integrin and suggest that inhibitors of alpha5 integrin may be useful in combating this process
23499550 The level of miR-92a expression was significantly inversely correlated with ITGA5 expression in various cancer cells.
23465222 Calreticulin, integrin-alpha5, and TGF-beta1 expression was increased in atrial tissue in patients with AF and was related to AF type, suggesting that calreticulin is involved in the pathogenesis of AF in VHD patients.
23416109 Mechanical regulation of alpha5beta1 integrin-ligand interactions in a molecular mechanism for cell adhesion strengthening by cyclic forces.
23389628 Data indicate that CD9 acts as scaffold and assembles a ternary JAM-A-CD9-alphavbeta3 integrin complex from which JAM-A is released upon bFGF stimulation.
23373994 High Integrin alpha5beta1 expression is associated with metastasis of colorectal cancer.
23233531 miR-148b controls malignancy by coordinating a novel pathway involving over 130 genes and, in particular, it directly targets players of the integrin signaling, such as ITGA5, ROCK1, PIK3CA/p110alpha, and NRAS, as well as CSF1
23007402 EGF regulates alpha5beta1 integrin activation state in cancer cell lines through the p90RSK-dependent phosphorylation of filamin A.
22976495 Co-expression of c-Met and Integrin alpha5beta1 has mechanical significance in the early stages of human gastric cardia adenocarcinoma.
22940691 Endoglin-mediated fibronectin/alpha5beta1 integrin and TGF-beta1 pathway crosstalk switched the respone to TGF-beta1 from a promoter to a suppressor of migration, inhibiting TGF-beta1-mediated apoptosis, and partially mediating developmental angiogenesis in vivo.
22865233 Tauroursodeoxycholic acid induces in perfused rat liver and human HepG2 cells the rapid appearance of the active conformation of the beta subunit of alpha5beta1 integrins, followed by an activating phosphorylation of extracellular signal-regulated kinases.
22773839 PKCalpha constitutes a crucial component of the integrin alphav-mediated pathway(s) that promote p53 relocalization and melanoma survival.
22735632 Periostin had preferential binding to cholangiocarcinoma cells via ITGalpha5beta1 and blocking this receptor by either neutralizing antibody or siRNA could attenuate Periostin-induced invasion.
22723286 Host cell kinases, alpha5 and beta1 integrins, and Rac1 signalling on the microtubule cytoskeleton are important for non-typable Haemophilus influenzae invasion of respiratory epithelial cells.
22692860 Data indicate the role of CYR61 and alpha(V)beta5 integrin as proteins that cooperate to mediate cancer cell migration.
22644786 Specific adhesion of megakaryoblasts to fibronectin via both alpha5- and alpha4-integrin molecules and phorbol 12-myristate 13-acetate (PMA) is essential for pro-platelet-like formation of megakaryocytes.
22629380 betaig-h3 co-localized with integrin alpha5beta1 to enhance the invasion of U87 cells, and that calpain-2, is involved in this process, acting as a downstream molecule.
22581054 show further that MYC represses transcription of both subunits of alphavbeta3 integrin, and that exogenous expression of beta3 integrin in human breast cancer cells
22562249 Clinically relevant role for TbetaRIII in regulating integrin alpha5 localization, reveal a novel crosstalk mechanism between the integrin and TGF-beta superfamily signaling pathways.
22461623 describe the generation of sCD154 mutants that lost their ability to bind CD40 or alphaIIbbeta3 and show that CD154 residues involved in its binding to CD40 or alphaIIbbeta3 are distinct from those implicated in its interaction to alpha5beta1
22451694 crystal structure of the alpha5beta1 integrin headpiece fragment bound by an allosteric inhibitory antibody was determined at a 2.9-A resolution both in the absence and presence of a ligand peptide containing the Arg-Gly-Asp (RGD) sequence
22361176 HMGB-1 enhances the migration of chondrosarcoma cells by increasing alpha5beta1 integrin expression through the RAGE receptor/PI3K/Akt/c-Jun/AP-1 signal transduction pathway.
22287577 uPAR is an essential component of the network through which VEGF controls integrin redistribution and endothelial cell migration.
22241990 Alpha 5 integrin antibody 17E6 and alpha 5/beta 6 integrins inhibitor EMD 409849 inhibit HIV-1 infection of primary macrophages at an early stage of the virus cycle, suggesting the interaction of HIV-1 gp120 with alpha 5/beta 6 integrins
22227038 ZEB2 was found to activate integrin alpha5 and vimentin promoters by interacting with and activating transcription factor Sp1, suggesting that cooperation between ZEB2 and Sp1 represents a novel mechanism of mesenchymal gene activation during epithelial-mesenchymal transition
22171266 alphaVbeta3-integrin relocalizes nectin1 to lipid rafts, independently of herpes simplex virus 1.
22158781 Rv2468c engaged integrin VLA-5 (alpha5beta1) on CD4+ T cells through its FN-like RGD motif GRDGSPK.
22114305 WASH and Arp2/3 regulates integrin alpha5beta1-mediated invasive cell migration.
22095620 study here indicated that integrin alphaVbeta3 had lower affinity when the ADMIDAS was mutated
21951552 Alpha 5 integrin antibody 17E6 and alpha 5/beta 6 integrins inhibitor EMD 409849 inhibit HIV-1 infection of primary macrophages at an early stage of the virus cycle, suggesting the interaction of HIV-1 gp120 with alpha 5/beta 6 integrins
21933023 growth defects in mesenchymal stromal cells in myelodysplastic syndromes were significantly correlated with decreases in CD44 adhesion molecules and CD49e.
21913024 Data suggest that colorectal cancer (CRC)-derived integrin alphavbeta6 is involved in the establishment of tumor immune tolerance in local tissues.
21787362 The endoproteolytic cleavage of alphav subunits is necessary for alphavbeta5/beta6 integrin to control alpha2beta1 function and could thus play an essential role in colon cancer cell migration.
21762625 Integrin alpha5beta1 might involves the abnormal proliferation and migration of A549 cells through mediating ERK signal transduction pathway.
21747167 elevated levels of perlecan domain V have a role in brain repair post stroke via VEGF and brain endothelial cell alpha5beta1 integrin
21592318 The expression of the alpha5 gene in human uveal melanoma cell lines, was characterized.
21521694 Streptococcus pyogenes M49 plasminogen/plasmin binding facilitates keratinocyte invasion via integrin-integrin-linked kinase (ILK) pathways and protects from macrophage killing
21429937 Mesenchymal stem cell migration is regulated by fibronectin through alpha5beta1-integrin-mediated activation of PDGFR-beta and potentiation of PDGF-BB signals.
21374738 Data show that cagL-Y58E59 H. pylori infection predisposed an upward shift in integrin alpha5beta1 in the corpus, leading to more severe corpus chronic inflammation.
21352421 S100A4 protects gastric cancer cells from anoikis by regulation of alphav and alpha5 integrin expression, which sheds a novel light for the role of S100A4 in cancer metastasis
21344385 IGF-I enhances the migration of chondrosarcoma cells by increasing alpha5beta1 integrin expression through the IGF-I receptor/PI3K/Akt/NF-kappaB signal transduction pathway.
21343398 Our findings suggest a novel mechanism by which an EGFR-Src-Arg-cortactin pathway mediates functional maturation of invadopodia and breast cancer cell invasion
21337395 In cultured intervertebral disc cells, fibronectin fragment increased the expression of MMP9,MMP13m alpha 5 and beta1 integrin via the alpha5beta1 integrin receptor.
21224397 Integrin 5 1 facilitates cancer cell invasion through enhanced contractile forces
21210968 RNA interference-mediated knockdown of CD49e (alpha5 integrin chain) in human thymic epithelial cells modulates the expression of multiple genes and decreases thymocyte adhesion.
21178109 Engagement of alpha5beta1-integrin by fibronectin acutely enhances Cav1.2 calcium channel current in human embryonic kidney cells (HEK293-T) expressing Cav1.2.
21170718 investigation of role of ITGA5 in cancer: MMP9 activity is induced by EGF/FN in breast cancer cells by the activation of multiple signaling pathways (FAK, PI3 K, and ERK); integrin receptor alpha5beta1 (ITGA5/ITGB1) is required in these processes.
21119598 fibronectin promotes ovarian cancer invasion and metastasis through an alpha(5)beta(1)-integrin/c-Met/FAK/Src-dependent signaling pathway.
21119363 Lewis y can influence the biological behavior of a tumor cell as an important composition of integrins alpha5 and beta1 by some signal pathway, such as promoting cell adhesion and migration.
20713621 We propose that alpha(5)beta(1) integrin, which is associated with cholesterol-rich microdomains at the host cell surface, is required for NOD1 recognition of peptidoglycan and subsequent induction of NF-kappaB-dependent responses to H. pylori.
20686611 The interplay between alpha5-integrin and sFn contributes significantly to tissue cohesion and, depending on their level of expression, can mediate a shift from liquid to elastic behavior.
20643357 in migrating cells, a fraction of the endocytosed fibronectin receptor, alpha 5 beta 1 integrin, is sorted into multivesicular endosomes together with fibronectin and degraded in lysosomes
20565758 The expression levels of integrins alpha5, beta1 and beta3 predicted overall survival and disease free survival in early stage non-small cell lung cancer patients
20564209 Findings indicated the diverse roles of ITGA5 expression in breast cancer cells.
20528248 Downregulation of ITGA5 is associated with multiple myeloma.
20522645 Data demonstrate that tumor necrosis factor (TNF)alpha activates the integrin alpha(5)beta(1) without altering total expression levels of beta(1) integrin on human umbilical vein endothelial cells.
20514406 Interaction between IGFBP2 and integrin alpha5 accelerates cell adhesion, and this, in turn, enhances JNK-mediated glioma cell migration.
20471683 Crosstalk between T cells and bronchial fibroblasts obtained from asthmatic subjects involves CD40L/alpha 5 beta 1 interaction.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20352103 upon serum starvation, alpha(5)beta(1) integrin engagement could regulate specific pro-survival functions through the activation of GSK3beta
20339539 in the presence of alphavbeta3-integrin Rac1 is not required for tumor angiogenesis
20332668 EGF may influence proliferative vitreoretinopathy by promoting integrin-alpha(5) expression and subsequent proliferation and migration of retinal pigment epithelial cells.
20332114 Integrin alpha5 serves as a key mediator of Src and ErbB2-survival signaling in low adhesion states, which are necessary to block the pro-anoikis mediator Bim.
20172014 Transfection of the alpha1,2-fucosyltransferase gene into ovarian carcinoma-derived cells brought about elevated expression of integrin alpha5beta1 with Le(Y).
20133364 Interleukin-8 (CXCL8) stimulates trophoblast cell migration and invasion by increasing levels of integrins alpha5 and beta1
20118200 TMPRSS4 induces invasion and epithelial-mesenchymal transition through upregulation of integrin alpha5.
20097172 these data suggest that hypoxia promotes oral squamous cell carcinoma cell invasion that is elicited by HIF-1alpha-dependent alpha5 integrin and fibronectin induction.
20052536 17beta-estradiol enhances alpha(5) integrin subunit gene expression through ERalpha-Sp1 interaction and reduces cell motility and invasion of ERalpha-positive breast cancer cells.
19950288 This study demonstrates that an important antiinflammatory aspect of glucocorticoids is regulating the expression and function of alpha5 integrin.
19887442 Macroscopic currents from HEK 293 cells expressing murine BK channel alpha-subunits (mSlo) are acutely potentiated following alpha5beta1 integrin activation.
19847290 differentiated placental multipotent mesenchymal stromal cells may contribute to blood vessel formation, and this activity depends on integrin alpha(5)beta(1)
19843692 These findings not only reveal that ITGA5 is required for osteoblast differentiation of adult human mesenchymal stromal cells (hMSCs) but also provide a targeted strategy using ITGA5 agonists to promote the osteogenic capacity of hMSCs.
19822142 VAMP2 mediates the trafficking of alpha5beta1 integrin to the plasma membrane and VAMP2-dependent integrin trafficking is critical in cell adhesion, migration and survival.
19747169 new homology model of human integrin alpha5beta1 supports an important function for D3-A3 loop residues Trp157 and Ala158 in the binding of antagonists.
19710103 upregulated expression in lung adenocarcinoma cells following bacterial infection
19706683 Induction of alpha5-integrin expression is a key determinant by which inhibitors of TGFbeta type-I receptor kinase and VEGF synergistically promote angiogenesis.
19617714 Integrin alpha5beta1 controls invasion of the studied cells via regulation of MMP-2 collagenase expression which can occur either through signaling pathways involving PI-3K, Akt, and Erk protein kinases and the c-Jun.
19579970 Results assess uterine receptivity in women with unexplained infertility using beta1 integrin molecules VLA-4, -5, and -6 within endometrial tissue in comparison with fertile women.
19564406 Results describe the measurement of the force-dependent lifetimes of single bonds between a fibronectin fragment and an integrin alpha(5)beta(1)-Fc fusion protein or membrane alpha(5)beta(1).
19502598 heparan sulfate and alpha5beta1 integrin are required for the localization of endostatin in endothelial cell lipid rafts
19497979 These results suggest that alpha(5)-integrin up-regulation induced by E-cadherin loss under hypoxia has a crucial role in regulating the migration of extravillous trophoblast cells.
19478484 H. pylori induces the expression of integrin alpha(5) and beta(1) and adhesion of the cells to fibronectin through PAR2 which is induced and may be activated by trypsin in H. pylori-infected gastric epithelial cells.
19460753 Erythroid differentiation stimulated by hemin was greatly enhanced when K562 cells were induced to adhere to Fibronectin by activating VLA-5 with TNIIIA2, a peptide derived from tenascin-C.
19454674 The most potent CysLT(1) ligand, LTD(4), rapidly and significantly up-regulated alpha(4)beta(1) and alpha(5)beta(1) integrin-dependent adhesion of both primitive and committed hematopoietic progenitor cells
19443705 inhibition of the alpha5beta1 integrin reduces lymphangiogenesis in inflamed airways after M. pulmonis infection
19416892 Alpha5beta1-integrin controls ebolavirus entry by regulating endosomal cathepsins
19404550 Regulation of urokinase receptor function and pericellular proteolysis by the integrin alpha(5)beta(1).
19297531 This work demonstrates a novel role for FAK in integrin activation and the time-dependent generation of cell-extracellular matrix forces.
19276077 An N-glycosylation site on the beta-propeller domain of the integrin alpha5 subunit plays key roles in both its function and site-specific modification by beta1,4-N-acetylglucosaminyltransferase III.
19179533 findings show that alpha(5)beta(1) integrin switches between relaxed and tensioned states in response to myosin II-generated cytoskeletal force
19036703 TM4SF5 facilitates angiogenesis of neighboring endothelial cells through VEGF induction, mediated by cooperation between TM4SF5 and integrin alpha(5) of epithelial cells
18992284 The phenotypic changes observed after caveolin-1 modulation were mediated by alpha(5)beta(1) integrins.
18845630 GnT-V is expressed in human extravillous trophoblast and is involved in regulating trophoblast invasion through modifications of the oligosaccharide chains of alpha5beta1 integrin.
18775869 These results suggest that alpha5 gene expression is likely dictated by subtle alterations in the nuclear ratio of TFs that either repress (NFI) or activate (Sp1 and AP-1) alpha5 transcription in corneal epithelial cells.
18707587 Data suggest that alpha5beta1 intergrin controls invasion ability of MCF-7/ADR breast carcinoma cells by regulating expression of MMP-2, which involves PI-3K and Erk1/2 protein kinase signaling.
18687805 Extracellular Cyr61 interacts with alpha(5), alpha(6), and beta(1) integrins
18676743 EGF cooperates with alpha(5)beta(1) integrin signaling to induce EMT in cervical cancer cells via up-regulated Snail
18613064 Generated high throughput platform to examine interactions of type I collagen receptor alpha(2)beta(1) and fibronectin receptor alpha(5)beta(1) with peptide ligands to evaluate the effects of integrin cross-talk on adhesive responses.
18611961 The ability of alpha5 beta1 integrin to interact with soluble fibronectin may thus drive the cell-matrix adhesion and cytoskeletal organization required for a contractile, fibroblast-like morphology.
18590706 Oxidized LDL impairs angiogenic properties of endothelial progenitor cells at sub-apoptotic levels by downregulation of E-selectin and integrin alphavbeta5, both substantial mediators of EPC-endothelial cell
18583538 SPARC-mediated mobilization of adipose stromal (stem) cells through its effect on alpha5beta1 integrin complex provides a functional basis for the regulation of white adipose tissue body composition by SPARC.
18464290 Both integrins, v3 and v5, are involved in the glioma cell radioresistance through the integrin-linked kinase (ILK) and the small GTPase RhoB, at least by regulating the radiation-induced mitotic cell death.
18452157 This is the first time to report that alpha1,3FucT-VII can regulate the mRNA expression of integrin.
18445685 data identify PAI1 as a novel regulator of fibronectin matrix assembly, and indicate that this regulation occurs through a previously undescribed crosstalk between the alphavbeta5 and alpha5beta1 integrins
18328539 analysis of important residues within the central turn motifs present in the cytoplasmic tails of integrin alphaIIb and alphaV subunits
18243286 Integrin alpha5 subunit plays a significant role in TGF-beta1-induced fibronectin deposition on human airway smooth muscle.
18186923 Through interactions with alpha5beta1 integrin and thrombospondin, CD47/IAP may modulate chondrocyte responses to mechanical signals. (Integrin, alpha5beta1)
17664272 Notch1 ligand, Delta-like ligand-4, stimulates R-Ras-dependent alpha 5 beta 1 integrin-mediated adhesion, demonstrating the physiological relevance of this pathway.
17664256 Protein expression of ITGA5 decreased at labour and expression of these molecules was also observed in primary cultured human uterine SMCs.
17624082 There is low expression of the proteins and mRNA of ME491/CD63 and integrin alpha5 in ovarian cancer. The lower the pathological differentiation is, the more significant the loss of expression is and the more likely metastasis is.
17596295 KGF increased integrin alpha(5) expression by phosphorylating C/EBP-beta
17498594 findings suggest possible participation of alpha5beta1 integrin in the mechanism of local invasion of ameloblastomas
17490870 Integrin alpha5beta1 is critical for the chondrocyte hypertrophic differentiation induced by GTP-bound transglutaminase 2, and this induction is ligand dependent.
17482311 OPN plays a crucial role for tumor growth and angiogenesis of human lung cancer cells in vivo by interacting with alphavbeta3 integrin.
17472576 This study identified the beta1 integrins on primary smooth muscle cells that fibulin-5 interacts with, and showed that failure of fibulin-5 to activate these receptors limits cell spreading, migration and proliferation.
17406357 Modulation of cell adhesion is a normal physiological action of PTHrP, mediated by increasing integrin gene transcription.
17359518 Interaction of alpha-toxin with alpha5beta1-integrin and overproduction of TNF-alpha may contribute to destruction of epithelial cells during S. aureus infection.
17300927 integrins alpha5beta1 and alphaV are inhibited by lebectin and lebecetin snake venom lectins
17286276 CEA-mediated signaling involves clustering of CEA and co-clustering and activation of the alpha5beta1 and associated specific signaling elements on the internal surfaces of membrane microdomains
17133443 surface micron-scale topography modulates alpha(5)beta(1) integrin binding and FAK activation
17027088 These findings suggest that interaction with fibronectin through integrin alpha5 plays an important role in human extravillous trophoblast invasion.
17012251 integrin alpha5beta1 plays a pivotal role in the hypotonic stress-induced but not in the lysophosphatidic acid-induced responses
16959765 activities for cell spreading and migration for the alpha5 subunit carrying only three potential N-glycosylation sites (3-5 sites) on the beta-propeller were comparable with those of the wild type
16940508 the internalization of AAV2 in mammalian cells might follow a "click-to-fit" mechanism that involves the cooperative binding of heparan sulfate and alpha5beta1 integrin by the AAV2 capsids
16920931 This is the first report of direct binding of a Mycobacterium tuberculosis molecule to a receptor on human T cells resulting in a change in CD4+ T cell function
16818733 Alpha5beta1 (VLA-5) integrin is a major galectin-1-glycosylated counterreceptor involved in immune developmental synapse formation.
16756721 binding of CXCL12 to its receptor leads to enhanced expression of alpha5 and beta3 integrins
16569642 one mechanism by which IGFBP2 activates IGFBP2-induced cell mobility is through its interaction with integrin alpha5 and this interaction is specifically mediated through the RGD domain on IGFBP2
16547007 urokinase plasminogen receptor domain III controls a functional association with alpha5beta1 integrin and tumor growth
16473416 Alpha 5 integrin antibody 17E6 and alpha 5/beta 6 integrins inhibitor EMD 409849 inhibit HIV-1 infection of primary macrophages at an early stage of the virus cycle, suggesting the interaction of HIV-1 gp120 with alpha 5/beta 6 integrins
16457822 CCN2/CTGF enhances chondrocyte adhesion to FN through direct interaction of its C-terminal CT domain with FN, and alpha5beta1 is involved in this adhesion.
16430945 The integrin receptors of tenascin (TN) and fibronectin (FN) may be involved in cell processes such as growth, adhesion, migration and apoptosis.
16005200 integrin alphavbeta6, alphavbeta3, alphavbeta5, alpha5beta1 and alpha9beta1 binding to osteopontin is controlled by specific structural motifs that are recognized by extracellular proteases
15987366 ITGA5 mediates engraftment of GCSF-mobilized stem cells.
15983209 alpha3, alpha5, and alpha6 beta1 integrins are expressed in ductal cells at 8 weeks, before glucagon- and insulin-immunoreactive cells bud off in fetal pancrea.
15881415 findings suggest that only some P. aeruginosa strains can target Fn and their natural receptors alpha5beta1 integrins for adherence to A549 cells
15757908 integrin alpha5/beta1 exerts its tumor suppressor-like activity in colon cancer cells by inhibiting HER-2 signaling
15737747 Alpha5beta1-mediated adhesion of Ntera2 neuronal cells to fibronectin decreased apoptosis in response to serum withdrawal.
15728256 the alpha5 integrin subunit has a role in the induction of apoptosis triggered by FGFR2 activation in osteoblasts, and a Cbl-dependent mechanism is involved in the coordinated regulation of cell apoptosis induced by alpha5 integrin degradation
15699160 Alpha5beta1 integrin is required for up-regulation of IL-1 beta-dependent airway smooth muscle secretory responses by fibronectin.
15684035 Direct binding and regulation of alpha5beta1 by uPAR implies a modified "bent" integrin conformation can function in an alternative activation state with this and possibly other cis-acting membrane ligands.
15509657 Insulin-like growth factor I controls adhesion strength mediated by alpha5beta1 integrins in tumor cells
15500293 The integrin, alpha 5 was expressed by prostate cancer cells in vitro and by prostate tumors in vivo, and their expression was elevated at sites of bone metastasis compared to original prostate tumor.
15389531 integrin alpha5beta1 participates in the activation of both VEGFR-3 and its downstream PI3 kinase/Akt signaling pathway, which is essential for fibronectin-mediated lymphatic endothelial cell survival and proliferation.
15331608 Data show that squamous cell carcinoma cells escape suspension-induced, p53-mediated anoikis by forming multicellular aggregates that use fibronectin survival signals mediated by integrin alpha(v) and focal adhesion kinase.
15187087 results indicate a new interaction partner for the alpha(v)beta(3) integrin, the TGFbetaIIR, in which TGFbeta1-induced responses are potentiated in the presence alpha(v)beta(3) ligands
15100006 The marked decrease in integrin alpha5beta1 expressions was unique to aneurysmal aortic tissues and correlated to a decrease in density of smooth muscle cells
15090462 findings identify Glu-Pg as an adhesive ligand for integrins alphaMbeta2 and alpha5beta1 and suggest that alpha5beta1 may participate in the binding of soluble Glu-Pg and assist in its activation.
15051489 Role of alpha4, alpha5, and alphav integrin receptors--which are central to mediating interactions with these domains of FN--in regulating ssquamous cell carcinoma migration.
14998999 beta1,4-N-acetylglucosaminyltransferase III inhibits the function of alpha5beta1 integrin
14970227 Integrin alpha5beta1 and ADAM-17 interact in vitro and co-localize in migrating HeLa cells
14610084 Hox D3 coordinately regulates the expression of integrin alpha5beta1 and integrin alphavbeta3 during angiogenesis in vivo.
14596610 Disulfide bonding patterns of the integrin alpha 5 chain are demonstrated; new insights into a second bond between the heavy and light chains of alpha 5 are described.
12970173 The structural conformation of this protein, complexed wigh integrin beta1, complexed with fibronectin, is examined.
12871973 visualized the head region of integrin alpha 5 beta 1 in an inactive (Ca2+-occupied) state, and in complex with a fragment of fibronectin containing the RGD and synergy recognition sequences
12865438 VEGFR-1 secreted by endothelial cells interacts with the alpha 5 beta 1 integrin
12807887 alpha 5 beta 1 and alpha v beta 3 are both important but cell-specific fibrillin-1 receptors
12799374 identification of binding site in gamma C-domain of fibrinogen
12682293 endostatin competes with fibronectin/RGD cyclic peptide to bind alpha 5 beta 1 integrin
12639965 thymidine phosphorylase and 2-deoxyribose-induced focal adhesion kinase phosphorylation was blocked by the antibodies to integrins alpha 5 beta 1 and alpha v beta 3, directly linking their migration and signaling components
12595495 Alterations in alpha5beta1 levels induced by TGF-beta are mediated at least in part through the induction of CTGF in glomerular mesangium
12486108 integrin alpha5beta1 extracellular domain controls rhoA activity
12359771 Elevated expression of IL-8 (and not PTHrP) by MDA-MET cells is a phenotypic change that may be related to their enhanced ability to metastasize to the skeleton.
12220988 B. pertussis FHA up-regulates ICAM-1 expression on respiratory epithelial cells through interaction of its RGD site with host cell VLA-5 integrin, and that PT impairs this response
12174366 Expression of focal adhesion kinase and alpha5 and beta1 integrins in carcinomas and its clinical significance.
12138201 results suggest that engagement of the alpha 5 beta 1 integrin promotes an NF-kappa B-dependent program of gene expression that coordinately regulates angiogenesis and inflammation
12115183 The alpha5beta1 integrin provides matrix survival signals for normal and osteoarthritic human articular chondrocytes in vitro.
12081894 TGF-beta1-stimulated osteoblasts require intracellular calcium signaling for enhanced alpha5 integrin expression
12067900 Central role of alpha5beta1 integrin in vascular development in mouse embryos and embryoid bodies.
11937138 results suggest that the inadequate trophoblastic invasion, induced by antiphospholipid antibodies, can be the result of decreased alpha1 integrin and VE-cadherin and increased alpha5 integrin and E-cadherin expression in the trophoblast
11893752 Integrin activation involves a conformational change in the alpha 1 helix of the beta subunit A-domain
11877275 role in mediating adhesion and migration of activated cycling CD34+ hematopoietic progenitor cells onto fibronectin
11852236 The PDZ domain of TIP-2/GIPC interacts with the C-terminus of the integrin alpha5 and alpha6 subunits.
11741954 alternative pathway of pro-alpha(v) processing involving MT1-MMP: regulation of integrin functionality may be an important role of MT1-MMP in migrating tumor cells.
10713718 Alpha 5 integrin antibody 17E6 and alpha 5/beta 6 integrins inhibitor EMD 409849 inhibit HIV-1 infection of primary macrophages at an early stage of the virus cycle, suggesting the interaction of HIV-1 gp120 with alpha 5/beta 6 integrins
10397733 Alpha 5 integrin antibody 17E6 and alpha 5/beta 6 integrins inhibitor EMD 409849 inhibit HIV-1 infection of primary macrophages at an early stage of the virus cycle, suggesting the interaction of HIV-1 gp120 with alpha 5/beta 6 integrins
9916748 Alpha 5 integrin antibody 17E6 and alpha 5/beta 6 integrins inhibitor EMD 409849 inhibit HIV-1 infection of primary macrophages at an early stage of the virus cycle, suggesting the interaction of HIV-1 gp120 with alpha 5/beta 6 integrins
9223324 Alpha 5 integrin antibody 17E6 and alpha 5/beta 6 integrins inhibitor EMD 409849 inhibit HIV-1 infection of primary macrophages at an early stage of the virus cycle, suggesting the interaction of HIV-1 gp120 with alpha 5/beta 6 integrins
8757349 Alpha 5 integrin antibody 17E6 and alpha 5/beta 6 integrins inhibitor EMD 409849 inhibit HIV-1 infection of primary macrophages at an early stage of the virus cycle, suggesting the interaction of HIV-1 gp120 with alpha 5/beta 6 integrins
8599839 Alpha 5 integrin antibody 17E6 and alpha 5/beta 6 integrins inhibitor EMD 409849 inhibit HIV-1 infection of primary macrophages at an early stage of the virus cycle, suggesting the interaction of HIV-1 gp120 with alpha 5/beta 6 integrins
7690138 Alpha 5 integrin antibody 17E6 and alpha 5/beta 6 integrins inhibitor EMD 409849 inhibit HIV-1 infection of primary macrophages at an early stage of the virus cycle, suggesting the interaction of HIV-1 gp120 with alpha 5/beta 6 integrins
7539135 Alpha 5 integrin antibody 17E6 and alpha 5/beta 6 integrins inhibitor EMD 409849 inhibit HIV-1 infection of primary macrophages at an early stage of the virus cycle, suggesting the interaction of HIV-1 gp120 with alpha 5/beta 6 integrins
2202737 Alpha 5 integrin antibody 17E6 and alpha 5/beta 6 integrins inhibitor EMD 409849 inhibit HIV-1 infection of primary macrophages at an early stage of the virus cycle, suggesting the interaction of HIV-1 gp120 with alpha 5/beta 6 integrins

AA Sequence

MGSRTPESPLHAVQLRWGPRRRPPLLPLLLLLLPPPPRVGGFNLDAEAPAVLSGPPGSFFGFSVEFYRPG      1 - 70
TDGVSVLVGAPKANTSQPGVLQGGAVYLCPWGASPTQCTPIEFDSKGSRLLESSLSSSEGEEPVEYKSLQ     71 - 140
WFGATVRAHGSSILACAPLYSWRTEKEPLSDPVGTCYLSTDNFTRILEYAPCRSDFSWAAGQGYCQGGFS    141 - 210
AEFTKTGRVVLGGPGSYFWQGQILSATQEQIAESYYPEYLINLVQGQLQTRQASSIYDDSYLGYSVAVGE    211 - 280
FSGDDTEDFVAGVPKGNLTYGYVTILNGSDIRSLYNFSGEQMASYFGYAVAATDVNGDGLDDLLVGAPLL    281 - 350
MDRTPDGRPQEVGRVYVYLQHPAGIEPTPTLTLTGHDEFGRFGSSLTPLGDLDQDGYNDVAIGAPFGGET    351 - 420
QQGVVFVFPGGPGGLGSKPSQVLQPLWAASHTPDFFGSALRGGRDLDGNGYPDLIVGSFGVDKAVVYRGR    421 - 490
PIVSASASLTIFPAMFNPEERSCSLEGNPVACINLSFCLNASGKHVADSIGFTVELQLDWQKQKGGVRRA    491 - 560
LFLASRQATLTQTLLIQNGAREDCREMKIYLRNESEFRDKLSPIHIALNFSLDPQAPVDSHGLRPALHYQ    561 - 630
SKSRIEDKAQILLDCGEDNICVPDLQLEVFGEQNHVYLGDKNALNLTFHAQNVGEGGAYEAELRVTAPPE    631 - 700
AEYSGLVRHPGNFSSLSCDYFAVNQSRLLVCDLGNPMKAGASLWGGLRFTVPHLRDTKKTIQFDFQILSK    701 - 770
NLNNSQSDVVSFRLSVEAQAQVTLNGVSKPEAVLFPVSDWHPRDQPQKEEDLGPAVHHVYELINQGPSSI    771 - 840
SQGVLELSCPQALEGQQLLYVTRVTGLNCTTNHPINPKGLELDPEGSLHHQQKREAPSRSSASSGPQILK    841 - 910
CPEAECFRLRCELGPLHQQESQSLQLHFRVWAKTFLQREHQPFSLQCEAVYKALKMPYRILPRQLPQKER    911 - 980
QVATAVQWTKAEGSYGVPLWIIILAILFGLLLLGLLIYILYKLGFFKRSLPYGTAMEKAQLKPPATSDA     981 - 1049
//

Text Mined References (314)

PMID Year Title
26900962 2016 Alteration of Pituitary Tumor Transforming Gene-1 Regulates Trophoblast Invasion via the Integrin/Rho-Family Signaling Pathway.
26823759 2015 Effect of ITGA5 down-regulation on the migration capacity of human dental pulp stem cells.
26772401 2016 Integrin ?5 promotes tumor progression and is an independent unfavorable prognostic factor in esophageal squamous cell carcinoma.
26733684 2016 Activation of integrin ?5 mediated by flow requires its translocation to membrane lipid rafts in vascular endothelial cells.
26674523 2015 Genetic and Immunohistochemical Expression of Integrins ITGAV, ITGA6, and ITGA3 As Prognostic Factor for Colorectal Cancer: Models for Global and Disease-Free Survival.
26648324 2016 Effects of integrin ?5?1 on the proliferation and migration of human aortic vascular smooth muscle cells.
26578516 2016 Annexin A6 and Late Endosomal Cholesterol Modulate Integrin Recycling and Cell Migration.
26431475 2015 Functional Impact of Collagens on the Activity Directed by the Promoter of the ?5 Integrin Subunit Gene in Corneal Epithelial Cells.
26370503 2015 ?5?1 integrin recycling promotes Arp2/3-independent cancer cell invasion via the formin FHOD3.
26244551 2015 ?v?5 Integrin/FAK/PGC-1? Pathway Confers Protective Effects on Retinal Pigment Epithelium.
26159767 2015 Quantitative Glycoproteomic Analysis Identifies Platelet-Induced Increase of Monocyte Adhesion via the Up-Regulation of Very Late Antigen 5.
26139991 2015 Integrin ?v?6 sustains and promotes tumor invasive growth in colon cancer progression.
26076738 2015 Insulin-Like Growth Factor Binding Protein-2 Promotes Adhesion of Endothelial Progenitor Cells to Endothelial Cells via Integrin ?5?1.
25955828 2015 The NLRP3 Inflammasome Is a Pathogen Sensor for Invasive Entamoeba histolytica via Activation of ?5?1 Integrin at the Macrophage-Amebae Intercellular Junction.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25824336 2015 Small Molecule MYC Inhibitor Conjugated to Integrin-Targeted Nanoparticles Extends Survival in a Mouse Model of Disseminated Multiple Myeloma.
25808196 2015 Intensified antineoplastic effect by combining an HDAC-inhibitor, an mTOR-inhibitor and low dosed interferon alpha in prostate cancer cells.
25735609 2015 Angiopoietin-like protein 2 promotes inflammatory conditions in the ligamentum flavum in the pathogenesis of lumbar spinal canal stenosis by activating interleukin-6 expression.
25663698 2015 The integrin expression profile modulates orientation and dynamics of force transmission at cell-matrix adhesions.
25623744 2015 Bone Metastasis in Renal Cell Carcinoma is Preprogrammed in the Primary Tumor and Caused by AKT and Integrin ?5 Signaling.
25600770 2015 Twist1 and AP-1 cooperatively upregulate integrin ?5 expression to induce invasion and the epithelial-mesenchymal transition.
25537511 2015 MicroRNA-26a promotes anoikis in human hepatocellular carcinoma cells by targeting alpha5 integrin.
25398877 2015 Proinflammatory secreted phospholipase A2 type IIA (sPLA-IIA) induces integrin activation through direct binding to a newly identified binding site (site 2) in integrins ?v?3, ?4?1, and ?5?1.
25378411 2015 Plasminogen activator inhibitor-1 inhibits angiogenic signaling by uncoupling vascular endothelial growth factor receptor-2-?V?3 integrin cross talk.
25339175 2014 Influenza promotes collagen deposition via ?v?6 integrin-mediated transforming growth factor ? activation.
25242040 2014 Mesodermal expression of integrin ?5?1 regulates neural crest development and cardiovascular morphogenesis.
25237190 2014 Gln-362 of angiopoietin-2 mediates migration of tumor and endothelial cells through association with ?5?1 integrin.
25216363 2014 Dynamic catch of a Thy-1-?5?1+syndecan-4 trimolecular complex.
25212537 2014 A first-in-human study of the anti-?5?1 integrin monoclonal antibody PF-04605412 administered intravenously to patients with advanced solid tumors.
25174715 2014 Synergy of urokinase?type plasminogen activator receptor isomer (D1D2) and integrin ?5?1 causes malignant transformation of hepatic cells and the occurrence of liver cancer.
25092917 2014 LOXL2 status correlates with tumor stage and regulates integrin levels to promote tumor progression in ccRCC.
25062814 2014 The fate of internalized ?5 integrin is regulated by matrix-capable fibronectin.
25058375 2015 Relevance of the thyroid hormones-?v?3 pathway in primary myeloma bone marrow cells and to bortezomib action.
24965773 2014 Integrin-mediated first signal for inflammasome activation in intestinal epithelial cells.
24833794 2014 ?5?1 integrin signaling mediates oxidized low-density lipoprotein-induced inflammation and early atherosclerosis.
24671180 2014 9-cis-retinoic Acid and troglitazone impacts cellular adhesion, proliferation, and integrin expression in K562 cells.
24644284 2014 Urokinase-type plasminogen activator receptor (uPAR) ligation induces a raft-localized integrin signaling switch that mediates the hypermotile phenotype of fibrotic fibroblasts.
24550382 2014 The endothelin-integrin axis is involved in macrophage-induced breast cancer cell chemotactic interactions with endothelial cells.
24478423 2014 Roles of the putative integrin-binding motif of the human metapneumovirus fusion (f) protein in cell-cell fusion, viral infectivity, and pathogenesis.
24464580 2014 CCN2 suppresses catabolic effects of interleukin-1? through ?5?1 and ?V?3 integrins in nucleus pulposus cells: implications in intervertebral disc degeneration.
24463276 2014 Stage-specific functional roles of integrins in murine erythropoiesis.
24448647 2014 The secreted protein ANGPTL2 promotes metastasis of osteosarcoma cells through integrin ?5?1, p38 MAPK, and matrix metalloproteinases.
24440971 2013 Overexpression of integrin ?v in the human nasopharyngeal carcinoma associated with metastasis and progression.
24434435 2014 TMPRSS4 regulates levels of integrin ?5 in NSCLC through miR-205 activity to promote metastasis.
24312560 2013 RhoC interacts with integrin ?5?1 and enhances its trafficking in migrating pancreatic carcinoma cells.
24286194 2013 ?5?1 integrin induces the expression of noncartilaginous procollagen gene expression in articular chondrocytes cultured in monolayers.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24251463 2015 Molecular dynamics and docking simulation of a natural variant of Activated Protein C with impaired protease activity: implications for integrin-mediated antiseptic function.
24248895 2014 Increased expression of ?5?1-integrin is a prognostic marker for patients with gastric cancer.
24182341 2014 Cyclic hydrodynamic pressure induced proliferation of bladder smooth muscle cells via integrin alpha5 and FAK.
24176823 2014 Roles for GP IIb/IIIa and ?v?3 integrins in MDA-MB-231 cell invasion and shear flow-induced cancer cell mechanotransduction.
24109241 2013 Type I interferon and NF-?B activation elicited by herpes simplex virus gH/gL via ?v?3 integrin in epithelial and neuronal cell lines.
24085800 2014 SDF-1/CXCR4 axis promotes directional migration of colorectal cancer cells through upregulation of integrin ?v?6.
24011356 2013 Identification of novel integrin binding partners for calcium and integrin binding protein 1 (CIB1): structural and thermodynamic basis of CIB1 promiscuity.
23967087 2013 A ZO-1/?5?1-integrin complex regulates cytokinesis downstream of PKC? in NCI-H460 cells plated on fibronectin.
23886203 2013 Prognostic significance of ?5?1-integrin expression in cervical cancer.
23819010 2013 17-?-Estradiol counteracts the effects of high frequency electromagnetic fields on trophoblastic connexins and integrins.
23770848 2014 Oncogenic targeting of BRM drives malignancy through C/EBP?-dependent induction of ?5 integrin.
23765377 2013 Tissue transglutaminase mediates the pro-malignant effects of oncostatin M receptor over-expression in cervical squamous cell carcinoma.
23686445 2013 Significance of expression of ITGA5 and its splice variants in acute myeloid leukemia: a report from the Children's Oncology Group.
23664187 2013 Role of alpha5beta1 integrin and MIA (melanoma inhibitory activity) in the pathogenesis of vitiligo.
23658023 2013 Comparative proteomic analysis of supportive and unsupportive extracellular matrix substrates for human embryonic stem cell maintenance.
23640055 2013 Nuclear monomeric integrin ?v in cancer cells is a coactivator regulated by thyroid hormone.
23640047 2013 Survivin promotion of melanoma metastasis requires upregulation of ?5 integrin.
23499550 2013 miR-92a inhibits peritoneal dissemination of ovarian cancer cells by inhibiting integrin ?5 expression.
23465222 2013 Calreticulin overexpression correlates with integrin-?5 and transforming growth factor-?1 expression in the atria of patients with rheumatic valvular disease and atrial fibrillation.
23416109 2013 Cyclic mechanical reinforcement of integrin-ligand interactions.
23389628 2013 Tetraspanin CD9 links junctional adhesion molecule-A to ?v?3 integrin to mediate basic fibroblast growth factor-specific angiogenic signaling.
23373994 2013 Clinicopathological and prognostic significance of ?5?1-integrin and MMP-14 expressions in colorectal cancer.
23233531 2013 miR148b is a major coordinator of breast cancer progression in a relapse-associated microRNA signature by targeting ITGA5, ROCK1, PIK3CA, NRAS, and CSF1.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23154389 2013 Regulation of endodermal differentiation of human embryonic stem cells through integrin-ECM interactions.
23007402 2012 Epidermal growth factor (EGF) regulates ?5?1 integrin activation state in human cancer cell lines through the p90RSK-dependent phosphorylation of filamin A.
22976495 2012 Expression of the c-Met proto-oncogene and Integrin ?5?1 in human gastric cardia adenocarcinoma.
22940691 2012 Endoglin mediates fibronectin/?5?1 integrin and TGF-? pathway crosstalk in endothelial cells.
22865233 2013 ?5 ?1-integrins are sensors for tauroursodeoxycholic acid in hepatocytes.
22773839 2012 Protein kinase C? (PKC?) regulates p53 localization and melanoma cell survival downstream of integrin ?v in three-dimensional collagen and in vivo.
22740495 2012 Cleavage of endometrial ?-integrins into their functional forms is mediated by proprotein convertase 5/6.
22735632 2012 Periostin activates integrin ?5?1 through a PI3K/AKT?dependent pathway in invasion of cholangiocarcinoma.
22723286 2012 Host cell kinases, ?5 and ?1 integrins, and Rac1 signalling on the microtubule cytoskeleton are important for non-typable Haemophilus influenzae invasion of respiratory epithelial cells.
22692860 2012 The matrix protein CCN1/CYR61 is required for ?(V)?5-mediated cancer cell migration.
22644786 2012 Potentiated activation of VLA-4 and VLA-5 accelerates proplatelet-like formation.
22629380 2012 Human U87 astrocytoma cell invasion induced by interaction of ?ig-h3 with integrin ?5?1 involves calpain-2.
22581054 2012 MYC suppresses cancer metastasis by direct transcriptional silencing of ?v and ?3 integrin subunits.
22562249 2013 T?RIII/?-arrestin2 regulates integrin ?5?1 trafficking, function, and localization in epithelial cells.
22461623 2012 Functional interaction of CD154 protein with ?5?1 integrin is totally independent from its binding to ?IIb?3 integrin and CD40 molecules.
22451694 2012 Crystal structure of ?5?1 integrin ectodomain: atomic details of the fibronectin receptor.
22361176 2012 HMGB-1 induces cell motility and ?5?1 integrin expression in human chondrosarcoma cells.
22287577 2012 VEGF-induced endothelial cell migration requires urokinase receptor (uPAR)-dependent integrin redistribution.
22227038 2012 ZEB2 upregulates integrin ?5 expression through cooperation with Sp1 to induce invasion during epithelial-mesenchymal transition of human cancer cells.
22171266 2012 ?V?3-integrin relocalizes nectin1 and routes herpes simplex virus to lipid rafts.
22158781 2012 Rv2468c, a novel Mycobacterium tuberculosis protein that costimulates human CD4+ T cells through VLA-5.
22114305 2011 The Arp2/3 activator WASH regulates ?5?1-integrin-mediated invasive migration.
22095620 2012 Mutagenesis studies of the ? I domain metal ion binding sites on integrin ?V?3 ligand binding affinity.
21947080 2011 SHARPIN is an endogenous inhibitor of ?1-integrin activation.
21933023 2012 Intrinsic growth deficiencies of mesenchymal stromal cells in myelodysplastic syndromes.
21913024 2012 Integrin alphavbeta6 promotes tumor tolerance in colorectal cancer.
21787362 2011 ?v integrin processing interferes with the cross-talk between ?v?5/?6 and ?2?1 integrins.
21762625 2011 [Effect of Integrin ?5?1-mediated ERK signal pathway on proliferation and migration of A549 cells].
21747167 2011 Perlecan domain V is neuroprotective and proangiogenic following ischemic stroke in rodents.
21592318 2011 Suppression of ?5 gene expression is closely related to the tumorigenic properties of uveal melanoma cell lines.
21521694 2011 Streptococcus pyogenes M49 plasminogen/plasmin binding facilitates keratinocyte invasion via integrin-integrin-linked kinase (ILK) pathways and protects from macrophage killing.
21429937 2011 Mesenchymal stem cell migration is regulated by fibronectin through ?5?1-integrin-mediated activation of PDGFR-? and potentiation of growth factor signals.
21423176 2011 Analysis of the myosin-II-responsive focal adhesion proteome reveals a role for ?-Pix in negative regulation of focal adhesion maturation.
21374738 2011 H. pylori cagL amino acid sequence polymorphism Y58E59 induces a corpus shift of gastric integrin ?5?1 related with gastric carcinogenesis.
21352421 2011 S100A4 protects gastric cancer cells from anoikis through regulation of ?v and ?5 integrin.
21344385 2011 IGF-I enhances ?5?1 integrin expression and cell motility in human chondrosarcoma cells.
21343398 2011 Steroid receptor coactivator-1 upregulates integrin ?? expression to promote breast cancer cell adhesion and migration.
21337395 2011 Fibronectin fragment activation of ERK increasing integrin ?? and ?? subunit expression to degenerate nucleus pulposus cells.
21269460 2011 Initial characterization of the human central proteome.
21224397 2011 Integrin ?5?1 facilitates cancer cell invasion through enhanced contractile forces.
21210968 2010 RNA interference-mediated knockdown of CD49e (?5 integrin chain) in human thymic epithelial cells modulates the expression of multiple genes and decreases thymocyte adhesion.
21178109 2011 Spatial association of the Cav1.2 calcium channel with ?5?1-integrin.
21170718 2011 Epigallocatechin-3-gallate (EGCG) downregulates EGF-induced MMP-9 in breast cancer cells: involvement of integrin receptor ?5?1 in the process.
21119598 2011 Ligand-independent activation of c-Met by fibronectin and ?(5)?(1)-integrin regulates ovarian cancer invasion and metastasis.
21119363 2010 Expression and correlation of Lewis y antigen and integrins ?5 and ?1 in ovarian serous and mucinous carcinoma.
20713621 2010 Helicobacter pylori exploits cholesterol-rich microdomains for induction of NF-kappaB-dependent responses and peptidoglycan delivery in epithelial cells.
20686611 2010 Alpha5beta1 integrin-fibronectin interactions specify liquid to solid phase transition of 3D cellular aggregates.
20643357 2010 Ubiquitination of alpha 5 beta 1 integrin controls fibroblast migration through lysosomal degradation of fibronectin-integrin complexes.
20565758 2010 Integrin expression profiling identifies integrin alpha5 and beta1 as prognostic factors in early stage non-small cell lung cancer.
20564209 2010 Functional elucidation and methylation-mediated downregulation of ITGA5 gene in breast cancer cell line MDA-MB-468.
20563599 2010 Integrin expression and integrin-mediated adhesion in vitro of human multipotent stromal cells (MSCs) to endothelial cells from various blood vessels.
20528248 2010 Number of expressed cancer/testis antigens identifies focal adhesion pathway genes as possible targets for multiple myeloma therapy.
20522645 2010 Tumor necrosis factor-induced neutrophil adhesion occurs via sphingosine kinase-1-dependent activation of endothelial {alpha}5{beta}1 integrin.
20514406 2010 JNK mediates insulin-like growth factor binding protein 2/integrin alpha5-dependent glioma cell migration.
20471683 2010 Crosstalk between T cells and bronchial fibroblasts obtained from asthmatic subjects involves CD40L/alpha 5 beta 1 interaction.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20352103 2010 A New alpha5beta1 integrin-dependent survival pathway through GSK3beta activation in leukemic cells.
20339539 2010 Endothelial-Rac1 is not required for tumor angiogenesis unless alphavbeta3-integrin is absent.
20332668 2010 Integrin-alpha5 mediates epidermal growth factor-induced retinal pigment epithelial cell proliferation and migration.
20332114 2010 ErbB2 requires integrin alpha5 for anoikis resistance via Src regulation of receptor activity in human mammary epithelial cells.
20172014 2010 Enhancement of the adhesive and spreading potentials of ovarian carcinoma RMG-1 cells due to increased expression of integrin alpha5beta1 with the Lewis Y-structure on transfection of the alpha1,2-fucosyltransferase gene.
20133364 2010 Interleukin-8 (CXCL8) stimulates trophoblast cell migration and invasion by increasing levels of matrix metalloproteinase (MMP)2 and MMP9 and integrins alpha5 and beta1.
20118200 2010 TMPRSS4 induces invasion and epithelial-mesenchymal transition through upregulation of integrin alpha5 and its signaling pathways.
20097172 2010 Hypoxia-inducible factor-1alpha mediates oral squamous cell carcinoma invasion via upregulation of alpha5 integrin and fibronectin.
20052536 2010 17?-estradiol enhances ?(5) integrin subunit gene expression through ER?-Sp1 interaction and reduces cell motility and invasion of ER?-positive breast cancer cells.
19950288 2009 Glucocorticoids increase alpha5 integrin expression and adhesion of synovial fibroblasts but inhibit ERK signaling, migration, and cartilage invasion.
19933311 2010 Characterization of integrin engagement during defined human embryonic stem cell culture.
19887442 2010 Alpha5beta1 integrin engagement increases large conductance, Ca2+-activated K+ channel current and Ca2+ sensitivity through c-src-mediated channel phosphorylation.
19847290 2009 Angiogenesis in differentiated placental multipotent mesenchymal stromal cells is dependent on integrin alpha5beta1.
19843692 2009 Priming integrin alpha5 promotes human mesenchymal stromal cell osteoblast differentiation and osteogenesis.
19822142 2010 Vesicle-associated membrane protein 2 mediates trafficking of alpha5beta1 integrin to the plasma membrane.
19747169 2009 Mapping the ligand-binding pocket of integrin alpha5beta1 using a gain-of-function approach.
19710103 2010 Up-regulation of integrin expression in lung adenocarcinoma cells caused by bacterial infection: in vitro study.
19706683 2009 VEGF and inhibitors of TGFbeta type-I receptor kinase synergistically promote blood-vessel formation by inducing alpha5-integrin expression.
19617714 2009 Integrin alpha5beta1 controls invasion of human breast carcinoma cells by direct and indirect modulation of MMP-2 collagenase activity.
19581412 2009 Quantitative proteomics identifies a Dab2/integrin module regulating cell migration.
19579970 2009 An immunohistochemical study of beta1 integrin molecules (VLA-4, VLA-5, VLA-6) in all endometrial compartments of fertile and infertile women in Ahwaz-Iran.
19564406 2009 Demonstration of catch bonds between an integrin and its ligand.
19502598 2009 Molecular interplay between endostatin, integrins, and heparan sulfate.
19497979 2009 Up-regulation of alpha5-integrin by E-cadherin loss in hypoxia and its key role in the migration of extravillous trophoblast cells during early implantation.
19478484 2009 Proteinase-activated receptor-2 mediates the expression of integrin alpha5 and beta1 in Helicobacter pylori-infected gastric epithelial AGS cells.
19460962 2009 MicroRNA-92a controls angiogenesis and functional recovery of ischemic tissues in mice.
19460753 2009 VLA-5-mediated adhesion to fibronectin accelerates hemin-stimulated erythroid differentiation of K562 cells through induction of VLA-4 expression.
19454674 2009 The CysLT1 ligand leukotriene D4 supports alpha4beta1- and alpha5beta1-mediated adhesion and proliferation of CD34+ hematopoietic progenitor cells.
19443705 2009 alpha5beta1 Integrin blockade inhibits lymphangiogenesis in airway inflammation.
19416892 2009 Alpha5beta1-integrin controls ebolavirus entry by regulating endosomal cathepsins.
19404550 2009 Regulation of urokinase receptor function and pericellular proteolysis by the integrin alpha(5)beta(1).
19349973 2009 Mass-spectrometric identification and relative quantification of N-linked cell surface glycoproteins.
19297531 2009 Focal adhesion kinase modulates cell adhesion strengthening via integrin activation.
19276077 2009 An N-glycosylation site on the beta-propeller domain of the integrin alpha5 subunit plays key roles in both its function and site-specific modification by beta1,4-N-acetylglucosaminyltransferase III.
19267251 2009 Cooperation between integrin alphavbeta3 and VEGFR2 in angiogenesis.
19179533 2009 Mechanically activated integrin switch controls alpha5beta1 function.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
19036703 2009 Cooperation between integrin alpha5 and tetraspan TM4SF5 regulates VEGF-mediated angiogenic activity.
18992284 2009 Caveolin-1 regulates glioblastoma aggressiveness through the control of alpha(5)beta(1) integrin expression and modulates glioblastoma responsiveness to SJ749, an alpha(5)beta(1) integrin antagonist.
18845630 2009 N-acetylglucosaminyltransferase V regulates extravillous trophoblast invasion through glycosylation of alpha5beta1 integrin.
18775869 2009 Differential binding of the transcription factors Sp1, AP-1, and NFI to the promoter of the human alpha5 integrin gene dictates its transcriptional activity.
18707587 2008 Implication of alpha5beta1 integrin in invasion of drug-resistant MCF-7/ADR breast carcinoma cells: a role for MMP-2 collagenase.
18687805 2008 Thrombin receptor and RhoA mediate cell proliferation through integrins and cysteine-rich protein 61.
18676743 2008 Epithelial-mesenchymal transition in cervical cancer: correlation with tumor progression, epidermal growth factor receptor overexpression, and snail up-regulation.
18635536 2008 Pro-inflammatory secretory phospholipase A2 type IIA binds to integrins alphavbeta3 and alpha4beta1 and induces proliferation of monocytic cells in an integrin-dependent manner.
18613064 2008 Mixed extracellular matrix ligands synergistically modulate integrin adhesion and signaling.
18611961 2008 Binding of soluble fibronectin to integrin alpha5 beta1 - link to focal adhesion redistribution and contractile shape.
18590706 2008 Oxidized low density lipoprotein impairs endothelial progenitor cell function by downregulation of E-selectin and integrin alpha(v)beta5.
18583538 2008 IFATS collection: Combinatorial peptides identify alpha5beta1 integrin as a receptor for the matricellular protein SPARC on adipose stromal cells.
18464290 2008 Alphavbeta3 and alphavbeta5 integrins control glioma cell response to ionising radiation through ILK and RhoB.
18452157 2008 alpha1,3 fucosyltransferase-VII up-regulates the mRNA of alpha5 integrin and its biological function.
18445685 2008 PAI1 stimulates assembly of the fibronectin matrix in osteosarcoma cells through crosstalk between the alphavbeta5 and alpha5beta1 integrins.
18328539 2008 Identification of residues of functional importance within the central turn motifs present in the cytoplasmic tails of integrin alphaIIb and alphaV subunits.
18243286 2008 Transforming growth factor beta 1 increases fibronectin deposition through integrin receptor alpha 5 beta 1 on human airway smooth muscle.
18186923 2008 CD47 associates with alpha 5 integrin and regulates responses of human articular chondrocytes to mechanical stimulation in an in vitro model.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17664272 2007 Mammalian NOTCH-1 activates beta1 integrins via the small GTPase R-Ras.
17664256 2007 Differential expression of the metalloproteinase MMP3 and the alpha5 integrin subunit in human myometrium at labour.
17624082 2007 Expression and significance of the protein and mRNA of metastasis suppressor gene ME491/CD63 and integrin alpha5 in ovarian cancer tissues.
17596295 2007 KGF promotes integrin alpha5 expression through CCAAT/enhancer-binding protein-beta.
17498594 2007 Ameloblastoma and adenomatoid odontogenic tumor: the role of alpha2beta1, alpha3beta1, and alpha5beta1 integrins in local invasiveness and architectural characteristics.
17490870 2007 The integrin alpha5beta1 regulates chondrocyte hypertrophic differentiation induced by GTP-bound transglutaminase 2.
17482311 2007 Abrogation of the interaction between osteopontin and alphavbeta3 integrin reduces tumor growth of human lung cancer cells in mice.
17472576 2007 Fibulin-5 binds human smooth-muscle cells through alpha5beta1 and alpha4beta1 integrins, but does not support receptor activation.
17406357 2007 PTHrP increases transcriptional activity of the integrin subunit alpha5.
17359518 2007 Involvement of alpha5beta1-integrin and TNF-alpha in Staphylococcus aureus alpha-toxin-induced death of epithelial cells.
17300927 2007 Lebectin and lebecetin, two C-type lectins from snake venom, inhibit alpha5beta1 and alphaV-containing integrins.
17286276 2007 A co-clustering model involving alpha5beta1 integrin for the biological effects of GPI-anchored human carcinoembryonic antigen (CEA).
17158881 2007 alphaVbeta6 is a novel receptor for human fibrillin-1. Comparative studies of molecular determinants underlying integrin-rgd affinity and specificity.
17133443 2007 Integrin alpha(5) controls osteoblastic proliferation and differentiation responses to titanium substrates presenting different roughness characteristics in a roughness independent manner.
17027088 2007 Integrin alpha5 is involved in fibronectin-induced human extravillous trophoblast invasion.
17012251 2006 Pivotal role of integrin alpha5beta1 in hypotonic stress-induced responses of human endothelium.
16959765 2006 N-glycosylation of the beta-propeller domain of the integrin alpha5 subunit is essential for alpha5beta1 heterodimerization, expression on the cell surface, and its biological function.
16940508 2006 Adeno-associated virus type 2 contains an integrin alpha5beta1 binding domain essential for viral cell entry.
16920931 2006 Phosphatidylinositol mannoside from Mycobacterium tuberculosis binds alpha5beta1 integrin (VLA-5) on CD4+ T cells and induces adhesion to fibronectin.
16818733 2006 Clustering of pre-B cell integrins induces galectin-1-dependent pre-B cell receptor relocalization and activation.
16756721 2006 CXCR4 chemokine receptor mediates prostate tumor cell adhesion through alpha5 and beta3 integrins.
16754960 2006 Small GTPase Rab21 regulates cell adhesion and controls endosomal traffic of beta1-integrins.
16569642 2006 An interaction between insulin-like growth factor-binding protein 2 (IGFBP2) and integrin alpha5 is essential for IGFBP2-induced cell mobility.
16547007 2006 A region in urokinase plasminogen receptor domain III controlling a functional association with alpha5beta1 integrin and tumor growth.
16457822 2006 CT domain of CCN2/CTGF directly interacts with fibronectin and enhances cell adhesion of chondrocytes through integrin alpha5beta1.
16430945 2006 Immunohistochemical assessment of fibronectin and tenascin and their integrin receptors alpha5beta1 and alpha9beta1 in gastric and colorectal cancers with lymph node and liver metastases.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16341674 2005 Transcriptome analysis of human gastric cancer.
16051604 2005 Cartilage oligomeric matrix protein/thrombospondin 5 supports chondrocyte attachment through interaction with integrins.
16005200 2005 Distinct structural requirements for binding of the integrins alphavbeta6, alphavbeta3, alphavbeta5, alpha5beta1 and alpha9beta1 to osteopontin.
15987366 2005 The alpha4beta1 and alpha5beta1 integrins mediate engraftment of granulocyte-colony-stimulating factor-mobilized human hematopoietic progenitor cells.
15983209 2005 Role for beta1 integrin and its associated alpha3, alpha5, and alpha6 subunits in development of the human fetal pancreas.
15881415 2004 alpha5beta1 integrins and fibronectin are involved in adherence of the Pseudomonas aeruginosa ER97314 clinical strain to A549 cells.
15757908 2005 Integrin alpha5/beta1 expression mediates HER-2 down-regulation in colon cancer cells.
15737747 2005 Activation of integrin alpha5beta1 delays apoptosis of Ntera2 neuronal cells.
15728256 2005 Cbl-mediated ubiquitination of alpha5 integrin subunit mediates fibronectin-dependent osteoblast detachment and apoptosis induced by FGFR2 activation.
15699160 2005 Multiple beta 1 integrins mediate enhancement of human airway smooth muscle cytokine secretion by fibronectin and type I collagen.
15684035 2005 Regulation of alpha5beta1 integrin conformation and function by urokinase receptor binding.
15509657 2005 Insulin-like growth factor I controls adhesion strength mediated by alpha5beta1 integrins in motile carcinoma cells.
15500293 Metastatic properties of prostate cancer cells are controlled by VEGF.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15389531 2005 Extracellular matrix regulates endothelial functions through interaction of VEGFR-3 and integrin alpha5beta1.
15331608 2004 Squamous cell carcinoma cell aggregates escape suspension-induced, p53-mediated anoikis: fibronectin and integrin alphav mediate survival signals through focal adhesion kinase.
15187087 2004 alpha(v)beta(3) Integrin interacts with the transforming growth factor beta (TGFbeta) type II receptor to potentiate the proliferative effects of TGFbeta1 in living human lung fibroblasts.
15100006 2004 Differential expression of integrin alpha5beta1 in human abdominal aortic aneurysm and healthy aortic tissues and its significance in pathogenesis.
15090462 2004 Characterization of plasminogen as an adhesive ligand for integrins alphaMbeta2 (Mac-1) and alpha5beta1 (VLA-5).
15051489 2004 Functional differences between integrin alpha4 and integrins alpha5/alphav in modulating the motility of human oral squamous carcinoma cells in response to the V region and heparin-binding domain of fibronectin.
15006356 2004 A mitochondrial protein, Bit1, mediates apoptosis regulated by integrins and Groucho/TLE corepressors.
14998999 2004 Introduction of bisecting GlcNAc into integrin alpha5beta1 reduces ligand binding and down-regulates cell adhesion and cell migration.
14970227 2004 Integrin alpha5beta1 and ADAM-17 interact in vitro and co-localize in migrating HeLa cells.
14684825 2003 Genome-wide survey of human alternative pre-mRNA splicing with exon junction microarrays.
14610084 2004 The homeobox transcription factor Hox D3 promotes integrin alpha5beta1 expression and function during angiogenesis.
14596610 2003 Mass spectrometric based mapping of the disulfide bonding patterns of integrin alpha chains.
12970173 2003 Structure of integrin alpha5beta1 in complex with fibronectin.
12907437 2003 Alpha5beta1 integrin as a cellular coreceptor for human parvovirus B19: requirement of functional activation of beta1 integrin for viral entry.
12871973 2003 Structure of an integrin-ligand complex deduced from solution x-ray scattering and site-directed mutagenesis.
12865438 2003 Vascular endothelial growth factor receptor-1 is deposited in the extracellular matrix by endothelial cells and is a ligand for the alpha 5 beta 1 integrin.
12807887 2003 Cell adhesion to fibrillin-1 molecules and microfibrils is mediated by alpha 5 beta 1 and alpha v beta 3 integrins.
12799374 2003 Identification of a novel binding site for platelet integrins alpha IIb beta 3 (GPIIbIIIa) and alpha 5 beta 1 in the gamma C-domain of fibrinogen.
12695522 2003 CCN3 (NOV) is a novel angiogenic regulator of the CCN protein family.
12682293 2003 Human tumstatin and human endostatin exhibit distinct antiangiogenic activities mediated by alpha v beta 3 and alpha 5 beta 1 integrins.
12639965 2003 Thymidine phosphorylase and 2-deoxyribose stimulate human endothelial cell migration by specific activation of the integrins alpha 5 beta 1 and alpha V beta 3.
12595495 2003 CTGF mediates TGF-beta-induced fibronectin matrix deposition by upregulating active alpha5beta1 integrin in human mesangial cells.
12486108 2002 The fibronectin-binding integrins alpha5beta1 and alphavbeta3 differentially modulate RhoA-GTP loading, organization of cell matrix adhesions, and fibronectin fibrillogenesis.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12359771 2002 Endostatin associates with integrin alpha5beta1 and caveolin-1, and activates Src via a tyrosyl phosphatase-dependent pathway in human endothelial cells.
12220988 2002 Bordetella pertussis infection of human respiratory epithelial cells up-regulates intercellular adhesion molecule-1 expression: role of filamentous hemagglutinin and pertussis toxin.
12174366 2002 Expression of focal adhesion kinase and alpha5 and beta1 integrins in carcinomas and its clinical significance.
12138201 2002 Alpha 5 beta 1 integrin activates an NF-kappa B-dependent program of gene expression important for angiogenesis and inflammation.
12081894 2002 TGF-beta1-stimulated osteoblasts require intracellular calcium signaling for enhanced alpha5 integrin expression.
12042322 2002 Ancient ubiquitous protein 1 binds to the conserved membrane-proximal sequence of the cytoplasmic tail of the integrin alpha subunits that plays a crucial role in the inside-out signaling of alpha IIbbeta 3.
11937138 2002 Antiphospholid antibodies regulate the expression of trophoblast cell adhesion molecules.
11919189 2002 Integrin cytoplasmic domain-associated protein 1alpha (ICAP-1alpha ) interacts directly with the metastasis suppressor nm23-H2, and both proteins are targeted to newly formed cell adhesion sites upon integrin engagement.
11912194 2002 Insulin receptor substrate 4 associates with the protein IRAS.
11893752 2002 Integrin activation involves a conformational change in the alpha 1 helix of the beta subunit A-domain.
11877275 2002 Increased binding and defective migration across fibronectin of cycling hematopoietic progenitor cells.
11852236 2002 The PDZ domain of TIP-2/GIPC interacts with the C-terminus of the integrin alpha5 and alpha6 subunits.
11801679 2002 TNF-alpha potentiates C5a-stimulated eosinophil adhesion to human bronchial epithelial cells: a role for alpha 5 beta 1 integrin.
11741954 2002 An alternative processing of integrin alpha(v) subunit in tumor cells by membrane type-1 matrix metalloproteinase.
11555674 2001 Alpha5 and alpha2 integrin gene transfers mimic the PDGF-B-induced transformed phenotype of fibroblasts in human skin.
11479315 2001 PDZ interaction sites in integrin alpha subunits. T14853, TIP/GIPC binds to a type I recognition sequence in alpha 6A/alpha 5 and a novel sequence in alpha 6B.
11462216 2001 Fertilin beta and other ADAMs as integrin ligands: insights into cell adhesion and fertilization.
11158588 2001 Interaction of endostatin with integrins implicated in angiogenesis.
11149921 2001 Integrin activation by regulated dimerization and oligomerization of platelet endothelial cell adhesion molecule (PECAM)-1 from within the cell.
10888683 2000 Integrin alpha5/beta1 mediates fibronectin-dependent epithelial cell proliferation through epidermal growth factor receptor activation.
10871287 2000 Plasmin-sensitive dibasic sequences in the third fibronectin-like domain of L1-cell adhesion molecule (CAM) facilitate homomultimerization and concomitant integrin recruitment.
10848623 2000 alpha5beta1 integrin protects intestinal epithelial cells from apoptosis through a phosphatidylinositol 3-kinase and protein kinase B-dependent pathway.
10713718 2000 The HIV-1 vpr protein induces anoikis-resistance by modulating cell adhesion process and microfilament system assembly.
10673366 2000 A regulated interaction between alpha5beta1 integrin and osteopontin.
10626908 1999 Different integrins mediate cell spreading, haptotaxis and lateral migration of HaCaT keratinocytes on fibronectin.
10397733 1999 The Tat protein of human immunodeficiency virus type-1 promotes vascular cell growth and locomotion by engaging the alpha5beta1 and alphavbeta3 integrins and by mobilizing sequestered basic fibroblast growth factor.
10091938 1998 Integrin alpha5beta1: a potent inhibitor of experimental lung metastasis.
10082751 1999 Characterization of integrin expression in islets isolated from hamster, canine, porcine, and human pancreas.
10072872 1997 [Expression and detection of integrin alpha 5 beta 1, fibronectin and its fragment in patients with hepatocellular carcinoma].
10065872 1999 CD9 is expressed in extravillous trophoblasts in association with integrin alpha3 and integrin alpha5.
10022831 1999 Role of alphavbeta3 integrin in the activation of vascular endothelial growth factor receptor-2.
9916748 1999 IFN-gamma induces endothelial cells to proliferate and to invade the extracellular matrix in response to the HIV-1 Tat protein: implications for AIDS-Kaposi's sarcoma pathogenesis.
9809676 1998 Distribution of alpha3, alpha5 and alpha(v) integrin subunits in mature and immature human oocytes.
9790314 1998 Expression of alpha5 (CD49e) and alpha6 (CD49f) integrin subunits on T cells in the circulation and the lamina propria of normal and inflammatory bowel disease colonic mucosa.
9789327 1998 Integrins take partners: cross-talk between integrins and other membrane receptors.
9509387 Mesothelium expression of integrins in vivo and in vitro.
9361020 1997 The alphavbeta3 integrin regulates alpha5beta1-mediated cell migration toward fibronectin.
9314546 1997 Regulation of tenascin-C, a vascular smooth muscle cell survival factor that interacts with the alpha v beta 3 integrin to promote epidermal growth factor receptor phosphorylation and growth.
9238676 1996 The expression of alpha v, alpha 5, beta 1, and beta 3 integrin chains on ejaculated human spermatozoa varies with their functional state.
9223324 1997 Tat protein induces self-perpetuating permissivity for productive HIV-1 infection.
9211865 1997 Defining the topology of integrin alpha5beta1-fibronectin interactions using inhibitory anti-alpha5 and anti-beta1 monoclonal antibodies. Evidence that the synergy sequence of fibronectin is recognized by the amino-terminal repeats of the alpha5 subunit.
8980606 1997 Expression and function of integrins on hematopoietic progenitor cells.
8757349 1996 Pleiotropic effects of immobilized versus soluble recombinant HIV-1 Tat protein on CD3-mediated activation, induction of apoptosis, and HIV-1 long terminal repeat transactivation in purified CD4+ T lymphocytes.
8658014 1996 Integrin signaling and matrix assembly.
8599839 1996 Human immunodeficiency virus type 1 tat protein modulates fibronectin expression in thymic epithelial cells and impairs in vitro thymocyte development.
8562338 1996 Correlation between integrin alpha 5 expression and the malignant phenotype of transitional cell carcinoma.
8537347 1995 p190-B, a new member of the Rho GAP family, and Rho are induced to cluster after integrin cross-linking.
8387021 1993 Integrin and Arg-Gly-Asp dependence of cell adhesion to the native and unfolded triple helix of collagen type VI.
8034133 1994 The integrin subunits alpha 2, alpha 3, alpha 4, alpha 5, alpha 6, alpha V, beta 1 and beta 3 in fetal, infant and adult human spleen as detected by immunohistochemistry.
7861330 1994 Immunolocalization of alpha 2, alpha 5, and alpha 6 integrin subunits in salivary tissue and adenomas of the parotid gland.
7690138 1993 The Tat protein of human immunodeficiency virus type 1, a growth factor for AIDS Kaposi sarcoma and cytokine-activated vascular cells, induces adhesion of the same cell types by using integrin receptors recognizing the RGD amino acid sequence.
7592829 1995 A biochemical characterization of the binding of osteopontin to integrins alpha v beta 1 and alpha v beta 5.
7542116 1995 Differential expression of cell adhesion molecules by human hematopoietic progenitor cells from bone marrow and mobilized adult peripheral blood.
7539135 1995 Angiogenic properties of human immunodeficiency virus type 1 Tat protein.
7532190 1995 The adhesive and migratory effects of osteopontin are mediated via distinct cell surface integrins. Role of alpha v beta 3 in smooth muscle cell migration to osteopontin in vitro.
7504269 1993 Insulin-like growth factor binding protein 1 stimulates cell migration and binds to the alpha 5 beta 1 integrin by means of its Arg-Gly-Asp sequence.
3033641 1987 The very late antigen family of heterodimers is part of a superfamily of molecules involved in adhesion and embryogenesis.
2958481 1987 Amino acid sequence of the human fibronectin receptor.
2944883 1986 cDNA sequences from the alpha subunit of the fibronectin receptor predict a transmembrane domain and a short cytoplasmic peptide.
2846588 1988 The function of multiple extracellular matrix receptors in mediating cell adhesion to extracellular matrix: preparation of monoclonal antibodies to the fibronectin receptor that specifically inhibit cell adhesion to fibronectin and react with platelet glycoproteins Ic-IIa.
2454952 1988 Chromosomal localization of the genes for the vitronectin and fibronectin receptors alpha subunits and for platelet glycoproteins IIb and IIIa.
2450560 1987 Comparison of cDNA-derived protein sequences of the human fibronectin and vitronectin receptor alpha-subunits and platelet glycoprotein IIb.
2202737 1990 Identification of an Arg-Gly-Asp (RGD) cell adhesion site in human immunodeficiency virus type 1 transactivation protein, tat.
1834647 1991 The alpha 5 beta 1 fibronectin receptor. Characterization of the alpha 5 gene promoter.
1694173 1990 Purification and functional characterization of integrin alpha v beta 5. An adhesion receptor for vitronectin.
1693626 1990 Isolation of a novel integrin receptor mediating Arg-Gly-Asp-directed cell adhesion to fibronectin and type I collagen from human neuroblastoma cells. Association of a novel beta 1-related subunit with alpha v.