Property Summary

NCBI Gene PubMed Count 28
PubMed Score 11.59
PubTator Score 15.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (7)

Disease log2 FC p
osteosarcoma 2.922 2.7e-04
cystic fibrosis -1.720 4.8e-05
non-small cell lung carcinoma 1.300 7.7e-24
lung adenocarcinoma 1.500 1.0e-08
invasive ductal carcinoma 1.369 2.5e-03
ovarian cancer 2.200 1.1e-04
psoriasis -1.100 9.7e-22

Protein-protein Interaction (1)

Gene RIF (16)

PMID Text
26403263 FGF2 may be redirecting fibroblasts towards an anti-fibrotic phenotype during wound healing by overriding TGFb1 mediated ITGA11 expression.
24962729 glycated collagen in the cardiac interstitium triggers an autocrine TGF-beta2 signaling pathway that stimulates alpha11 integrin expression through Smad2/3 binding elements in the alpha11 integrin promoter
24520080 Myometrium and uterine fibroids express ITGA11.
22869616 Interactions between alpha11 integrins and the Smad-dependent TGF-beta2 signalling may contribute to the formation of pro-fibrotic myofibroblasts and the development of a fibrotic interstitium in diabetic cardiomyopathy.
21796158 The disturbance of alpha11beta1 mediated interactions to collagen I results in a tremendous reduction of hMSC numbers owing to mitochondrial leakage accompanied by Bcl-2-associated X protein upregulation.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19913614 Data show that the 3 kb alpha11 promoter contains most of the regulatory elements that direct ectomesenchymal and mesodermal fibroblast-specific expression.
19789190 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
19641149 is a major collagen receptor on human periodontal ligament cells [and plays] a role in collagen lattice remodeling [ITGA11B1]
19390575 Observational study of gene-disease association. (HuGE Navigator)
18990704 analysis of a prokaryotic Scl1 collagen sequence motif that mediates binding to human collagen receptors, integrins alpha2beta1 and alpha11beta1
18519826 Clinical trial and genome-wide association study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17600088 Through interaction between matrix collagen and stromal fibroblasts, integrin alpha 11 stimulates cancer cell growth.
16697656 A new interferon stimulated gene. (Integrin alpha 11)
12496264 the GFOGER sequence in fibrillar collagens is a common recognition motif used by integrins, particularly alpha11beta1
12392762 Major transcription start site mapped. A core promoter [nt (-)127-(+)25], a potential silencer region [nt (-)400-(-)127] and a potential enhancer region [nt (-)1519-(-)400] identified as important for alpha11 transcription in mesenchymal cells.

AA Sequence

MDLPRGLVVAWALSLWPGFTDTFNMDTRKPRVIPGSRTAFFGYTVQQHDISGNKWLVVGAPLETNGYQKT      1 - 70
GDVYKCPVIHGNCTKLNLGRVTLSNVSERKDNMRLGLSLATNPKDNSFLACSPLWSHECGSSYYTTGMCS     71 - 140
RVNSNFRFSKTVAPALQRCQTYMDIVIVLDGSNSIYPWVEVQHFLINILKKFYIGPGQIQVGVVQYGEDV    141 - 210
VHEFHLNDYRSVKDVVEAASHIEQRGGTETRTAFGIEFARSEAFQKGGRKGAKKVMIVITDGESHDSPDL    211 - 280
EKVIQQSERDNVTRYAVAVLGYYNRRGINPETFLNEIKYIASDPDDKHFFNVTDEAALKDIVDALGDRIF    281 - 350
SLEGTNKNETSFGLEMSQTGFSSHVVEDGVLLGAVGAYDWNGAVLKETSAGKVIPLRESYLKEFPEELKN    351 - 420
HGAYLGYTVTSVVSSRQGRVYVAGAPRFNHTGKVILFTMHNNRSLTIHQAMRGQQIGSYFGSEITSVDID    421 - 490
GDGVTDVLLVGAPMYFNEGRERGKVYVYELRQNLFVYNGTLKDSHSYQNARFGSSIASVRDLNQDSYNDV    491 - 560
VVGAPLEDNHAGAIYIFHGFRGSILKTPKQRITASELATGLQYFGCSIHGQLDLNEDGLIDLAVGALGNA    561 - 630
VILWSRPVVQINASLHFEPSKINIFHRDCKRSGRDATCLAAFLCFTPIFLAPHFQTTTVGIRYNATMDER    631 - 700
RYTPRAHLDEGGDRFTNRAVLLSSGQELCERINFHVLDTADYVKPVTFSVEYSLEDPDHGPMLDDGWPTT    701 - 770
LRVSVPFWNGCNEDEHCVPDLVLDARSDLPTAMEYCQRVLRKPAQDCSAYTLSFDTTVFIIESTRQRVAV    771 - 840
EATLENRGENAYSTVLNISQSANLQFASLIQKEDSDGSIECVNEERRLQKQVCNVSYPFFRAKAKVAFRL    841 - 910
DFEFSKSIFLHHLEIELAAGSDSNERDSTKEDNVAPLRFHLKYEADVLFTRSSSLSHYEVKPNSSLERYD    911 - 980
GIGPPFSCIFRIQNLGLFPIHGMMMKITIPIATRSGNRLLKLRDFLTDEANTSCNIWGNSTEYRPTPVEE    981 - 1050
DLRRAPQLNHSNSDVVSINCNIRLVPNQEINFHLLGNLWLRSLKALKYKSMKIMVNAALQRQFHSPFIFR   1051 - 1120
EEDPSRQIVFEISKQEDWQVPIWIIVGSTLGGLLLLALLVLALWKLGFFRSARRRREPGLDPTPKVLE     1121 - 1188
//

Text Mined References (31)

PMID Year Title
26403263 2016 FGF2 Overrides TGF?1-Driven Integrin ITGA11 Expression in Human Dermal Fibroblasts.
24962729 2015 Glycated Collagen Induces ?11 Integrin Expression Through TGF-?2 and Smad3.
24823363 2014 Citrullination of collagen II affects integrin-mediated cell adhesion in a receptor-specific manner.
24520080 2014 Collagen-binding ?11 integrin expression in human myometrium and fibroids utilizing a novel RNA in situ probe.
23382691 2013 Loci associated with N-glycosylation of human immunoglobulin G show pleiotropy with autoimmune diseases and haematological cancers.
23377640 2013 Common genetic variation and antidepressant efficacy in major depressive disorder: a meta-analysis of three genome-wide pharmacogenetic studies.
22869616 2012 ?11 integrin stimulates myofibroblast differentiation in diabetic cardiomyopathy.
21796158 2011 Integrins ?2?1 and ?11?1 regulate the survival of mesenchymal stem cells on collagen I.
21423176 2011 Analysis of the myosin-II-responsive focal adhesion proteome reveals a role for ?-Pix in negative regulation of focal adhesion maturation.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19913614 2010 The human alpha11 integrin promoter drives fibroblast-restricted expression in vivo and is regulated by TGF-beta1 in a Smad- and Sp1-dependent manner.
19789190 2009 A gene-based risk score for lung cancer susceptibility in smokers and ex-smokers.
19641149 2009 A role for alpha11beta1 integrin in the human periodontal ligament.
19390575 2009 Lung cancer susceptibility model based on age, family history and genetic variants.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
18990704 2008 Identification of the first prokaryotic collagen sequence motif that mediates binding to human collagen receptors, integrins alpha2beta1 and alpha11beta1.
18839057 2008 Molecular genetics of adult ADHD: converging evidence from genome-wide association and extended pedigree linkage studies.
18519826 2008 Molecular genetics of successful smoking cessation: convergent genome-wide association study results.
17600088 2007 Integrin alpha 11 regulates IGF2 expression in fibroblasts to enhance tumorigenicity of human non-small-cell lung cancer cells.
16754960 2006 Small GTPase Rab21 regulates cell adhesion and controls endosomal traffic of beta1-integrins.
16697656 2006 Integrin alpha 11 is a novel type I interferon stimulated gene.
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.
16210410 2005 Differential expression profiling of membrane proteins by quantitative proteomics in a human mesenchymal stem cell line undergoing osteoblast differentiation.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12496264 2003 alpha 11beta 1 integrin recognizes the GFOGER sequence in interstitial collagens.
12392762 2002 Analysis of the human integrin alpha11 gene (ITGA11) and its promoter.
11518510 2001 alpha11beta1 integrin is a receptor for interstitial collagens involved in cell migration and collagen reorganization on mesenchymal nonmuscle cells.
10486209 1999 Cloning, sequence analysis, and chromosomal localization of the novel human integrin alpha11 subunit (ITGA11).
10464311 1999 cDNA cloning and chromosomal localization of human alpha(11) integrin. A collagen-binding, I domain-containing, beta(1)-associated integrin alpha-chain present in muscle tissues.
8635876 1996 Isolation of genes differentially expressed in human primary myoblasts and embryonal rhabdomyosarcoma.