Property Summary

NCBI Gene PubMed Count 113
PubMed Score 109.66
PubTator Score 489.11

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
astrocytic glioma -2.200 1.2e-02
atypical teratoid / rhabdoid tumor 1.100 2.8e-07
ependymoma -2.300 2.6e-02
esophageal adenocarcinoma -1.200 3.4e-02
glioblastoma -1.700 1.4e-04
intraductal papillary-mucinous adenoma (... 1.100 3.6e-04
medulloblastoma -1.900 9.0e-05
medulloblastoma, large-cell -1.800 3.1e-04
non-small cell lung cancer 1.384 1.1e-20
oligodendroglioma -2.100 1.7e-02
osteosarcoma 1.533 4.4e-03
ovarian cancer 1.100 1.8e-05
primitive neuroectodermal tumor -1.300 1.0e-02
psoriasis 1.400 1.8e-03
sarcoidosis 1.100 4.6e-02
spina bifida -1.424 1.8e-02

Protein-protein Interaction (2)

Gene RIF (89)

AA Sequence

MSDSGSQLGSMGSLTMKSQLQITVISAKLKENKKNWFGPSPYVEVTVDGQSKKTEKCNNTNSPKWKQPLT      1 - 70
VIVTPVSKLHFRVWSHQTLKSDVLLGTAALDIYETLKSNNMKLEEVVVTLQLGGDKEPTETIGDLSICLD     71 - 140
GLQLESEVVTNGETTCSENGVSLCLPRLECNSAISAHCNLCLPGLSDSPISASRVAGFTGASQNDDGSRS    141 - 210
KDETRVSTNGSDDPEDAGAGENRRVSGNNSPSLSNGGFKPSRPPRPSRPPPPTPRRPASVNGSPSATSES    211 - 280
DGSSTGSLPPTNTNTNTSEGATSGLIIPLTISGGSGPRPLNPVTQAPLPPGWEQRVDQHGRVYYVDHVEK    281 - 350
RTTWDRPEPLPPGWERRVDNMGRIYYVDHFTRTTTWQRPTLESVRNYEQWQLQRSQLQGAMQQFNQRFIY    351 - 420
GNQDLFATSQSKEFDPLGPLPPGWEKRTDSNGRVYFVNHNTRITQWEDPRSQGQLNEKPLPEGWEMRFTV    421 - 490
DGIPYFVDHNRRTTTYIDPRTGKSALDNGPQIAYVRDFKAKVQYFRFWCQQLAMPQHIKITVTRKTLFED    491 - 560
SFQQIMSFSPQDLRRRLWVIFPGEEGLDYGGVAREWFFLLSHEVLNPMYCLFEYAGKDNYCLQINPASYI    561 - 630
NPDHLKYFRFIGRFIAMALFHGKFIDTGFSLPFYKRILNKPVGLKDLESIDPEFYNSLIWVKENNIEECD    631 - 700
LEMYFSVDKEILGEIKSHDLKPNGGNILVTEENKEEYIRMVAEWRLSRGVEEQTQAFFEGFNEILPQQYL    701 - 770
QYFDAKELEVLLCGMQEIDLNDWQRHAIYRHYARTSKQIMWFWQFVKEIDNEKRMRLLQFVTGTCRLPVG    771 - 840
GFADLMGSNGPQKFCIEKVGKENWLPRSHTCFNRLDLPPYKSYEQLKEKLLFAIEETEGFGQE           841 - 903
//

Text Mined References (125)

PMID Year Title