Property Summary

NCBI Gene PubMed Count 58
PubMed Score 61.70
PubTator Score 174.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6685 5.3e-34
Disease Target Count Z-score Confidence
Boutonneuse fever 7 3.477 1.7

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 1.200 5.3e-34

Protein-protein Interaction (11)

Gene RIF (34)

PMID Text
26397446 Interferonstimulated gene factor 3 complex, which consists of STAT1, STAT2 and IRF9, is required for the induction of SAMHD1 expression by IFN-alpha in SMMC-7721 cells.
26216956 U-ISGF3 induced by IFN-lambdas and -beta drives prolonged expression of a set of IFN-stimulated genes during HCV infection
25319116 IRF9 is a vascular injury-response molecule that promotes VSMC proliferation. IRF9 expression is upregulated during neointima formation.
25278262 DC-SIGN-induced ISGF3 by fucose-based PAMPs has an essential role in driving IL-27 and subsequent TFH polarization, which might be harnessed for vaccination design
25156627 STAT2 and IRF9 overexpression is sufficient to drive interferon-related DNA damage signature expression upon cell crowding.
25150882 IRF9 mediated myocardial reperfusion injury
23913484 IL6 is an inducer of IRF9 expression in prostate cancer and a sensitizer for the antiproliferative effects of IFNalpha2.
22902549 The hepatitis C virus (HCV) non-structural 5A (NS5A) protein, which is known to modulate the IFN response, competes with IRF9 for CypA binding and can prevent the formation of IRF9-CypA complexes.
21957129 HDAC1 and HDAC2 differentially modulate STAT activity in response to IFNalpha2: while they are required for the induction of ISGF3-responsive genes, they impair the transcription of STAT3-dependent genes.
21697347 Western blot and electrophoretic mobility-shift assays identified the interferon-stimulated gene factor-3 (ISGF-3) components STAT1 and IRF-9 as the proximal targets of human herpesvirus 8 vIRF-2 activity.
21268015 Signals ensued by IFN-alpha and IL-4 induce cytoplasmic sequestration of IL-4-activated STAT6 and IFN-alpha-activated STAT2:p48 in B cells through the formation of pY-STAT6:pY-STAT2:p48 complex.
20980339 Observational study of gene-disease association. (HuGE Navigator)
20964804 Results suggest that the amount of cellular IRF9 is a crucial determinant for amplification of early dynamics of IFNalpha-mediated signal transduction.
20943654 analysis of IFN-stimulated response elements (ISREs) that bind to both the IFN-stimulated gene factor 3 (ISGF3) as well as to IFN response factor 7 (IRF7)
20634891 Observational study of gene-disease association. (HuGE Navigator)
20503287 Observational study of gene-disease association. (HuGE Navigator)
20403236 STAT2 may interact with IRF-9 in a STAT1-independent manner. The complex STAT2/IRF-9 is the key factor mediating the expression of RIG-G gene regulated by IFN-alpha.
20389019 NOD1 can activate the ISGF3 signaling pathway that is usually associated with protection against viral infection to provide robust type I IFN-mediated protection from H. pylori and possibly other mucosal infections
20331378 Observational study of gene-disease association. (HuGE Navigator)
19752753 a key factor for eliciting the antiproliferative activity of IFN-alpha in tumors
19604093 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19258923 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18456457 The data suggest that liberation of the IFNaR2-ICD by regulated proteolysis could trigger a novel mechanism for moving the transcription factor Stat2 to the nucleus.
18370868 These data define the role of the ISGF3 members in IFN-beta inhibitory signaling.
17703412 Observational study of gene-disease association. (HuGE Navigator)
17559358 Suggest that the JAK-STAT pathway may play a major role in mediating the effects of IFN-alpha against hepatitis b virus, and that ISGF3 might be a key factor.
16849320 Results identify Viperin as a tightly regulated ISGF3 target gene, which is counter-regulated by PRDI-BF1.
16689942 Data reveal the existence of a collection of GAS-regulated target genes whose expression is interferon-inducible and independent of ISGF3 but highly dependent on the STAT2 DNA binding domain.
16595158 Pretreatment of Huh-7 cells with 0.5-1 mM H2O2 resulted in the suppression of the IFN-alpha-induced antiviral protein MxA and of IRF-9 mRNA expression.
16318580 GBF1 is recruited to the endogenous IRF-9 promoter, and interacts with C/EBP-beta, IL-1, and IL-6
15714000 defects in ISGF3 can cause resistance to IFN-alpha(2a) treatment
15668228 the conserved DNA-binding domain of STAT2 has a role specific to the activity of ISGF3-independent STAT2-containing complexes
15194680 IRF9 functions to recruit RNA polymerase II to the promoter of interferon-stimulated genes and requires histone deacetylases
12509459 the IFN-activated ISGF3 transcription factor regulates transcription through contact with DRIP150

AA Sequence

MASGRARCTRKLRNWVVEQVESGQFPGVCWDDTAKTMFRIPWKHAGKQDFREDQDAAFFKAWAIFKGKYK      1 - 70
EGDTGGPAVWKTRLRCALNKSSEFKEVPERGRMDVAEPYKVYQLLPPGIVSGQPGTQKVPSKRQHSSVSS     71 - 140
ERKEEEDAMQNCTLSPSVLQDSLNNEEEGASGGAVHSDIGSSSSSSSPEPQEVTDTTEAPFQGDQRSLEF    141 - 210
LLPPEPDYSLLLTFIYNGRVVGEAQVQSLDCRLVAEPSGSESSMEQVLFPKPGPLEPTQRLLSQLERGIL    211 - 280
VASNPRGLFVQRLCPIPISWNAPQAPPGPGPHLLPSNECVELFRTAYFCRDLVRYFQGLGPPPKFQVTLN    281 - 350
FWEESHGSSHTPQNLITVKMEQAFARYLLEQTPEQQAAILSLV                               351 - 393
//

Text Mined References (58)

PMID Year Title
26397446 2015 Interferon-stimulated gene factor 3 complex is required for the induction of sterile ? motif and HD domain-containing protein 1 expression by interferon-? in SMMC-7721 cells.
26216956 2015 Roles of unphosphorylated ISGF3 in HCV infection and interferon responsiveness.
25319116 2014 Interferon regulatory factor 9 is critical for neointima formation following vascular injury.
25278262 2014 Fucose-based PAMPs prime dendritic cells for follicular T helper cell polarization via DC-SIGN-dependent IL-27 production.
25156627 2015 Cell crowding induces interferon regulatory factor 9, which confers resistance to chemotherapeutic drugs.
25150882 2014 Interferon regulatory factor 9 is an essential mediator of heart dysfunction and cell death following myocardial ischemia/reperfusion injury.
24882218 2014 Unanchored K48-linked polyubiquitin synthesized by the E3-ubiquitin ligase TRIM6 stimulates the interferon-IKK? kinase-mediated antiviral response.
24065129 2013 IFN?-dependent increases in STAT1, STAT2, and IRF9 mediate resistance to viruses and DNA damage.
23913484 2013 IL6 sensitizes prostate cancer to the antiproliferative effect of IFN?2 through IRF9.
22902549 2013 HCV NS5A and IRF9 compete for CypA binding.
21957129 2012 Opposed regulation of type I IFN-induced STAT3 and ISGF3 transcriptional activities by histone deacetylases (HDACS) 1 and 2.
21903422 2011 Mapping a dynamic innate immunity protein interaction network regulating type I interferon production.
21697347 2011 Kaposi's sarcoma-associated herpesvirus viral interferon regulatory factor-2 inhibits type 1 interferon signalling by targeting interferon-stimulated gene factor-3.
21268015 2011 Counter-regulation mechanism of IL-4 and IFN-? signal transduction through cytosolic retention of the pY-STAT6:pY-STAT2:p48 complex.
20980339 2011 Hepatitis B viraemia: its heritability and association with common genetic variation in the interferon gamma signalling pathway.
20964804 2010 Combining theoretical analysis and experimental data generation reveals IRF9 as a crucial factor for accelerating interferon ?-induced early antiviral signalling.
20943654 2010 Transcription factor redundancy ensures induction of the antiviral state.
20634891 2010 Maternal genes and facial clefts in offspring: a comprehensive search for genetic associations in two population-based cleft studies from Scandinavia.
20503287 2010 Interleukin-9 polymorphism in infants with respiratory syncytial virus infection: an opposite effect in boys and girls.
20403236 2010 [A novel molecular mechanism of interferon alpha-regulated expression of retinoic acid-induced gene G].
20389019 2010 NOD1 contributes to mouse host defense against Helicobacter pylori via induction of type I IFN and activation of the ISGF3 signaling pathway.
20331378 2010 Large-scale candidate gene analysis of spontaneous clearance of hepatitis C virus.
19752753 2009 IRF9 is a key factor for eliciting the antiproliferative activity of IFN-alpha.
19604093 2009 Genetic polymorphisms, their allele combinations and IFN-beta treatment response in Irish multiple sclerosis patients.
19258923 2009 Genetic susceptibility to respiratory syncytial virus bronchiolitis in preterm children is associated with airway remodeling genes and innate immune genes.
18456457 2008 Nuclear transit of the intracellular domain of the interferon receptor subunit IFNaR2 requires Stat2 and Irf9.
18370868 2008 IFN-beta-mediated inhibition of IL-8 expression requires the ISGF3 components Stat1, Stat2, and IRF-9.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17923090 2007 Acetylation-dependent signal transduction for type I interferon receptor.
17703412 2007 Genetic susceptibility to respiratory syncytial virus bronchiolitis is predominantly associated with innate immune genes.
17559358 2008 Role of ISGF3 in modulating the anti-hepatitis B virus activity of interferon-alpha in vitro.
17351669 2007 STAT activation and differential complex formation dictate selectivity of interferon responses.
17121613 2006 Mapping of nine porcine interferon regulatory factor genes.
16849320 2006 Toll-like receptor-dependent and -independent viperin gene expression and counter-regulation by PRDI-binding factor-1/BLIMP1.
16689942 2006 Identification of GAS-dependent interferon-sensitive target genes whose transcription is STAT2-dependent but ISGF3-independent.
16595158 2006 Oxidative stress inhibits IFN-alpha-induced antiviral gene expression by blocking the JAK-STAT pathway.
16318580 2005 Development of monoclonal antibodies against GBF1 and their use in studying its functions.
15714000 2004 Reduction in p48-ISGFgamma levels confers resistance to interferon-alpha2a in MHCC97 cells.
15668228 2005 Functional relevance of the conserved DNA-binding domain of STAT2.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15194680 2004 Histone deacetylase activity is required to recruit RNA polymerase II to the promoters of selected interferon-stimulated early response genes.
15093743 2004 Identification of the protein Zibra, its genomic organization, regulation, and expression in breast cancer cells.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12693554 2003 Characterization of long cDNA clones from human adult spleen. II. The complete sequences of 81 cDNA clones.
12509459 2003 Role of metazoan mediator proteins in interferon-responsive transcription.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12060499 2002 Resistance to interferons in melanoma cells does not correlate with the expression or activation of signal transducer and activator of transcription 1 (Stat1).
11997525 2002 A novel interferon regulatory factor (IRF), IRF-10, has a unique role in immune defense and is induced by the v-Rel oncoprotein.
11846981 2002 Nuclear/cytoplasmic localization of IRFs in response to viral infection or interferon stimulation.
10860992 2000 Interferon regulatory factor subcellular localization is determined by a bipartite nuclear localization signal in the DNA-binding domain and interaction with cytoplasmic retention factors.
10702714 1999 Viral inhibition of interferon signal transduction.
10199920 1999 Organization of the genes encoding the human proteasome activators PA28alpha and beta.
9417904 1997 Mapping and characterization of novel (CAG)n repeat cDNAs from adult human brain derived by the oligo capture method.
9242679 1997 Distinct STAT structure promotes interaction of STAT2 with the p48 subunit of the interferon-alpha-stimulated transcription factor ISGF3.
8943351 1996 Interactions between STAT and non-STAT proteins in the interferon-stimulated gene factor 3 transcription complex.
8454630 1993 In vitro activation of the transcription factor ISGF3 by interferon alpha involves a membrane-associated tyrosine phosphatase and tyrosine kinase.
7829101 1994 Isolation of novel and known genes from a human fetal cochlear cDNA library using subtractive hybridization and differential screening.
1630447 1992 Subunit of an alpha-interferon-responsive transcription factor is related to interferon regulatory factor and Myb families of DNA-binding proteins.