Property Summary

NCBI Gene PubMed Count 228
PubMed Score 786.34
PubTator Score 494.43

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Expression

  Differential Expression (26)

Disease log2 FC p
Multiple myeloma 1.512 1.7e-02
urothelial carcinoma -1.300 3.1e-02
esophageal adenocarcinoma 1.300 2.2e-02
cutaneous lupus erythematosus 2.100 6.7e-04
psoriasis 1.600 9.7e-04
osteosarcoma -1.050 2.7e-02
chronic lymphosyte leukemia -1.100 2.3e-05
posterior fossa group A ependymoma 1.700 3.6e-06
glioblastoma 1.100 1.1e-02
juvenile dermatomyositis 1.208 8.3e-10
primary pancreatic ductal adenocarcinoma 1.090 7.4e-03
non-small cell lung cancer -1.562 8.3e-11
intraductal papillary-mucinous neoplasm ... 1.200 4.9e-02
lung cancer -2.600 1.1e-04
active Crohn's disease 1.891 7.9e-04
active ulcerative colitis 1.527 7.5e-03
diabetes mellitus -1.200 7.1e-03
interstitial cystitis 2.000 5.5e-03
pilocytic astrocytoma 1.100 1.9e-05
primary Sjogren syndrome 1.200 4.2e-02
invasive ductal carcinoma -1.578 9.4e-05
lung carcinoma -2.100 4.5e-12
Bipolar Disorder 1.244 3.9e-02
ovarian cancer 1.400 5.7e-04
dermatomyositis 1.200 1.3e-02
head and neck cancer 1.300 2.3e-02

 GWAS Trait (1)

MLP Assay (2)

AID Type Active / Inconclusive / Inactive Description
449758 other 0 / 0 / 5 Late stage assay provider counterscreen results from the probe development effort to identify STAT1 inhibitors: fluorescence-based cell-based quantitative PCR assay to identify inhibitors of IRF-1 gene expression
449759 screening 0 / 0 / 8 Late stage assay provider counterscreen results from the probe development effort to identify STAT1 activators: fluorescence-based cell-based quantitative PCR assay to identify activators of IRF-1 gene expression

Gene RIF (210)

PMID Text
26872335 IRF1 is a transcriptional regulator of IRG1 in human macrophages.
26674566 IRF1 upregulation in fetal membranes and myometrium after term labor indicates a proinflammatory role for IRF1 in human parturition. IRF1 is involved in TLR- and cytokine-mediated signaling in human myometrium.
26510961 5AZ had a protective effect after MI by potentiation of IRF1 sumoylation and is suggested as a novel therapeutic intervention for cardiac repair.
26362649 Gene expression meta-analysis reveals immune response convergence on the IFNgamma-STAT1-IRF1 axis and adaptive immune resistance mechanisms in lymphoma
26011589 Data show that ectopic expression of interferon regulatory factor 1 (IRF-1) reduces NF-kappa B activity and suppresses TNF receptor-associated factor 2 (TRAF2) and inhibitor of apoptosis 1 protein (cIAP1) expression in breast cancer cells.
25997853 The present data demonstrate that IRF-1 could effectively promote the immune maturation and function of dendritic cells in ACS Acute Coronary Syndrome patients.
25964490 IRF-1 promotes LTx I/R injury via hepatocyte IL-15/IL-15Ralpha production and suggest that targeting IRF-1 and IL-15/IL-15Ralpha may be effective in reducing I/R injury associated with LTx.
25658920 IRF1, a transcription factor, regulates miR-203 transcription by binding to the miR-203 promoter.
25611806 IRF1 directly interacts with chromatin modifying enzymes, supporting a model where recruitment to specific target genes is mediated in part by IRF1.
25592039 A positive feedback loop between IRF1 and miR-29b may contribute to the sensitivity of colorectal cancer cells to IFN-gamma by repressing IGF1.
25576084 silencing IRF1 promoted autophagy by increasing BECN1 and blunting IGF1 receptor and mTOR survival signaling
25501823 IRF1 is a dual regulator of BV6-induced apoptosis and inflammatory cytokine secretion.
25497010 Data indicate that the interferon regulatory factor (IRF1) promotion was observed in cancer cell lines treated with different MEK inhibitors or with RNAi oligonucleotides against extracellular signal-regulated kinases (ERK1/2).
25418955 IRF-1 is an important signaling protein in the interferon pathway. It not only activates gene expression as a transcription factor, but may perpetuate disease by leading to a dysregulated epigenome
25347735 IRF1 re-expression in human cancer cells causes cells to become resistant to infection by the oncolytic vesicular stomatitis virus strain.
25312803 IRF-1 regulates the transcription of target genes which play essential roles in various physiological and pathological processes, including viral infection, tumor immune surveillance, pro-inflammatory injury, development of immune system. (Review)
25014791 Single nucleotide polymorphisms in RBPJ, IL1R1, REV3L, TRAF3IP2, IRF1 and ICOS showed association with rheumatoid arthritis in black South Africans.
24995581 Transcriptome analysis identifies IRF1 as being associated with platinum sensitivity and an independent predictor of both PFS and OS in HGSOC
24940638 The miR-31/IRF-1/CTSS pathway may play a functional role in the pathogenesis of cystic fibrosis lung disease.
24886089 The present study further suggests that the combined targeted inhibition of STAT1, ARTD8, ARTD9 and/or DTX3L could increase the efficacy of chemotherapy or radiation treatment in prostate and other high-risk tumor types with an increased STAT1 signaling.
24650050 The novel AS regulatory activities attributed to IRF-1 indicate that the IFN-gamma response involves a global change in both gene transcription and AS in breast epithelial cells.
24632547 Data suggest that interferon regulatory factors 1 and 2 (IRF1 and IRF2) may serve as potential targets of therapy.
24464131 we found that IRF1 was essential for IL-1-induced expression of the chemokines CXCL10 and CCL5
24396068 IKK-epsilon phosphorylated the transcription factor IFN regulatory factor 1 (IRF-1).
23934855 Data demonstrate direct roles for fluid shear stress and postprandial triglyceride-rich lipoprotein from human serum in the regulation of IRF-1 expression and downstream inflammatory responses in aortic endothelial cells.
23811275 Identification of a functional IRF-1-binding site in the first intron of human optineurin gene that mediates interferon-gamma-induced activation of the promoter, is reported.
23807161 findings suggest that the responsiveness of IRF-1 to the immune cytokines IFN-gamma and TNF-alpha is able to point out two different cancer phenotypes and support the central role of such transcription factor in influencing different tumour behaviors
23799084 Three polymorphisms in the IRF1 gene that protect against HIV-1 acquisition appear to exert no discernable effects once infection is established.
23554911 KGF could up-regulate IL-7 expression through the STAT1/IRF-1, IRF-2 signaling pathway, which is a new insight in potential effects of KGF on the intestinal mucosal immune system.
23487038 BAL1 represses the anti-proliferative and pro-apoptotic IFNgamma-STAT1-IRF1-p53 axis and mediates proliferation, survival and chemo-resistance in DLBCL.
23378427 Expression of interferon regulatory factor (IRF)1 and signal transducer and activator of transcription (STAT)1 mediates host defense against Mycobacterium tuberculosis through the cellular response to interferon (IFN)-gamma.
23333304 HIV-1 Vif downregulates the expression of interferon regulatory factor 1 (IRF1) in Vif-expression T cells
23255602 Smad7 was able to activate the caspase 8 promoter through recruitment of the interferon regulatory factor 1 (IRF1) transcription factor to the interferon-stimulated response element (ISRE) site.
23226549 IRF-1 also activates IFP35 expression in an IFN-gamma-inducible manner.
23134341 The E3 docking site was not available when IRF1 was in its DNA-bound conformation and cognate DNA-binding sequences strongly suppressed ubiquitination, showing a relationship between ligase binding and site-specific modification in the DNA-binding domain
23071666 Data show that not only NF-kB p65, but also the interferon regulatory factor 1 (IRF1) and certain antigen rocessing achinery (APM) components are low in a subset of Neuroblastoma (NB) cell lines with aggressive features.
23046934 The increased expressions of OB-R, IRF-1 and GR-beta in airway smooth muscle cells (ASMCs) of obese rats with asthma may play a role in the onset of obese asthma and glucocorticoid resistance.
23040881 An association study of functional polymorphic genes IRF-1, ...... with disease progression, aspartate aminotransferase, alanine aminotransferase, and viral load in chronic hepatitis B and C.
22879909 The association of IRF1 and IRF8 variants with tuberculosis susceptibility was investigated.
22874466 Subjects with an anti-inflammatory response to a meal produced triglycerides that was enriched in nonesterified fatty acids, decreased IRF-1 expression, increased miR-126 activity, and diminished monocyte arrest.
22401175 Immunohistochemically, the lining synovium of Rheumatoid Aarthritis clearly expressed IRF1
22367195 We propose that IRF1 activation is responsible for carcinogen-induced Poleta up-regulation, which contributes to mutagenesis and ultimately carcinogenesis in cells.
22345458 K1L and C7L antagonize IRF1-induced antiviral activities and that the host modulation function of C7L is evolutionally conserved in all poxviruses that can readily replicate in tissue-cultured mammalian cells.
22213332 The modulation of IRFs seen in filarial (and presumably other tissue-sensitive helminths) underlies suppression of malaria-specific cytokines/chemokines that play a crucial role in immunity to malaria.
22096509 Data observed in DMD and aging skeletal muscle enrichment in motifs for candidate transcription factors that may coordinate either the immune/fibrosis responses (ETS1, IRF1, NF1) or the mitochondrial metabolism (ESRRA).
21834067 IRF-1 is a key regulator of IL-18BPa expression and IL-18 bioactivity in rheumatoid arthritis synovial fibroblasts.
21803131 Data suggest that the new 18bp consensus motif appears to have a greater association with biological activities of IRF1.
21790247 IRF-1 gene deletions were not observed in 19 (38%) patients. In our study, the frequency of deletions of these three exons was slightly higher than in an Indian population (52%), but lower than in Sweden in Europe (95%).
21725055 IFN-gamma induces expression of IRF-1 in human erythroid precursors.
21683060 BRG1-dependent induction of TRIM22 perfectly correlated with BRG1-dependent recruitment of IRF-1 to TRIM22 promoter.
21586271 These results suggested that HBZ has dual suppressive effects on IRF-1 function, which may contribute to HTLV-1 related pathogenesis.
21411754 HIV infection of dendritic cells subverts the IFN induction pathway via IRF-1 and inhibits type 1 IFN production.
21389130 The authors show that the human papillomavirus type 16 E5 protein expression per se stimulates IFN-beta expression this stimulation is specifically mediated by the induction of interferon regulatory factor 1.
21288140 We show persistent activation of the Th1 (interferon-gamma) signaling pathway markers signal transducer and activator of transcription 1 (STAT1) and IRF1 in the small intestine of celiac disease children despite gluten-free diet.
21257209 The findings of our study indicate that IRF-1 signaling in glial cells serves as a final common pathway of inflammatory demyelination and may have important clinical implications in MS.
21245151 analysis of binding of NPM1, TRIM28, and YB-1 to the Mf2 domain of IRF-1
21200019 Transitory IRF1 responsiveness in HIV-Resistance may be one of the key contributors to the altered susceptibility to HIV infection during the early stages of primary HIV infection.
20980339 Observational study of gene-disease association. (HuGE Navigator)
20947504 a complex relationship between CHIP and IRF-1
20861350 Lysophosphatidic acid inhibits CCL5/RANTES production in a human bronchial epithelial cell line by blocking the binding of IRF-1 to the CCL5/RANTES promoter
20846942 This study found evidence for a bidirectional regulation of IRF-1 gene expression controlled by single-nucleotide polymorphism rs2549009 in cis and a yet unidentified variant or haplotype or on environmental control in trans.
20817723 a role for the Mf1 domain in limiting both IRF-1-dependent transcription and the rate of IRF-1 turnover.
20588308 Observational study of gene-disease association. (HuGE Navigator)
20533260 STAT2 and IRF-1 comppete at binding interferon-stimulated response elements (ISREs) located on the retinoic acid-induced gene G (RIG-G) promoter in RIG-G.
20525893 IRF-1 is critical for interleukin (IL)-12p40 and IL-12p70 production induced in dendritic cells by nickel sulfate associated with interferon (IFN)-gamma.
20503287 Observational study of gene-disease association. (HuGE Navigator)
20485362 Observational study of gene-disease association. (HuGE Navigator)
20459687 Observational study of gene-disease association. (HuGE Navigator)
20457620 IFNgamma restores breast cancer sensitivity to fulvestrant by regulating STAT1, IFN regulatory factor 1, NF-kappaB, BCL2 family members.
20435892 IL-27 p28 gene transcription is activated by interferon regulatory factor 8 in cooperation with interferon regulatory factor 1
20177960 gene silencing downregulates Th1 cell function in patients with acute coronary syndrome
20177805 We found that mice lacking IRF-1 in the central nervous system developed significantly milder clinical symptoms and shorter disease duration in experimental autoimmune encephalomyelitis
20031577 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20031576 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19880820 Human rhinovirus-16-induced CXCL10 production is dependent upon IRF-1.
19858727 IRF-1 could be nominated as one of the tumor suppressor factors and could aid in the early detection of HCC.-e
19851330 We conclude that IRF-1 can induce apoptosis by the intrinsic pathway independent of the extrinsic pathway by upregulation of PUMA.
19845895 Observational study of gene-disease association. (HuGE Navigator)
19805480 the cellular accumulation of IRF-1 may represent a potential molecular mechanism mediating altered cellular response to GC through the depletion of GRIP-1 from the GR transcriptional regulatory complexes
19697121 Our findings strongly imply a tumor suppressor role for the IRF1 gene in breast cancer.
19692168 Observational study of gene-disease association. (HuGE Navigator)
19642896 Data show that increased level of NPM/B23 in conjunction with decreased level of IRF1 could aid GAGE-induced resistance to IFN-gamma.
19625176 Observational study of gene-disease association. (HuGE Navigator)
19574175 IRF-1-E7 was shown to be responsible for the positive regulation of many interleukins and to be involved in the differentiation of T-helper cells in cervical cancer
19548631 The levels of E-selectin, ICAM-1, IL-11, IRF-1, IL-6, IL-1beta and LIF genes expression in the B. pseudomallei-infected cells were 1.5-5 times lower than in the B. thailandensis-infected cells.
19536153 Observational study of gene-disease association. (HuGE Navigator)
19502235 the role of the Mf1 domain of IRF-1 in orchestrating the recruitment of regulatory factors that can impact on both its turnover and transcriptional activity.
19463200 association between gene polymorphism and chlidhood asthma
19450680 Interferon regulatory factor 1 degradation is a multi-step process to be regulated in response to cell signalling, polyubiquitination by a specific E3-ligase and recognition of polyubiquitinated interferon regulatory factor 1 to the proteasome.
19433065 siRNA against IRF-1 prevents IFN-gamma-mediated CD80 activation
19428110 HLA-A upregulation in liver cancer was mediated by both increased nuclear aggregation of transcription factor p65 and upregulation of transcription factor IRF-1.
19426920 mRNA levels are up-regulated in the peripheral blood cells of primary Sjogren Syndrome patients
19404407 IRF-1, IRF-7, type I IFNs, and STAT1 form a signaling feedback loop that is critical in regulating TRAIL expression in HIV-1-infected macrophages.
19345417 High levels of IRF-1 in myeloid cells are a favorable prognostic factor for overall survival in myelodysplastic syndromes but they increase the probability of manifestation of autoimmune phenomena, with a diminished quality of life.
19295429 genetic polymorphism is associated with atopic asthma in children
19258923 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19247692 Observational study of gene-disease association. (HuGE Navigator)
19170196 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19145247 Observational study of gene-disease association. (HuGE Navigator)
19131452 Observational study of gene-disease association. (HuGE Navigator)
19129219 A ChIP-chip approach identifies a novel role for the transcription factor IRF1 in the DNA damage response elicited by DNA interstrand crosslinks.
19056926 JNK1 stimulated and mediated the effects of IFN and TNF-alpha on XAF1 expression through transcriptional regulation by induction of IRF-1.
19028144 Interferon regulatory factor 1 (IRF1) polymorphisms with minor allele frequencies higher than 5% and haplotype frequencies in two Southeast Asian populations (Indonesian and Vietnamese) turned out not to be associated with pulmonary tuberculosis.
19028144 Observational study of gene-disease association. (HuGE Navigator)
19012493 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18986693 NO inhibits HRV-16-induced production of CXCL10 by inhibiting viral activation of nuclear factor kappaB and of IRFs, including IRF-1, through a cGMP-independent pathway
18694960 These data reveal a novel "feed-forward" mechanism induced by NF-kappaB which ensures that acutely synthesized IRF-1 operates in concert with NF-kappaB to amplify the immunoproteasome and antigen-processing functions of CD40.
18688264 FOXA1 and IRF-1 intermediary transcriptional regulators of PPARgamma-induced urothelial cytodifferentiation
18678606 TNF-alpha and PGE2 induce a complex that binds an oligonucleotide derived from the IRF1 promoter in dendritic cells.
18676680 Observational study of gene-disease association. (HuGE Navigator)
18655181 involvement of IRF-1 in the regulation of SLC26A6 gene expression by IFNgamma in the human intestine
18641303 IRF-1 is a key negative regulator of CD4(+)CD25(+) Treg cells through direct repression of Foxp3 expression[IFN regulatory factor 1]
18454680 Observational study of gene-disease association. (HuGE Navigator)
18401423 Although STAT1 phosphorylation required JNK and p38MAPK activation, only JNK activation was essential for IRF1 promoter activation by Tie2-R849W.
18381204 KAP1 interacts with STAT1 and regulates IFN/STAT1-mediated IRF-1 gene expression in collaboration with HDACs.
18338947 data show that genetic variants in the IRF-1 and Stat1 genes of the IFN pathway are associated with multiple sclerosis and hepatitis c virus infection.
18338947 Observational study of gene-disease association. (HuGE Navigator)
18316378 Dendritic cell priming by L. major infection results in the early activation of NF-kappaB transcription factors and the up-regulation and nuclear translocation of interferon regulatory factor 1 (IRF-1) and IRF-8.
18216101 These data indicate that in early phases of HIV-1 infection or during virus reactivation from latency, IRF-1 is an additional component of the p50/p65 heterodimer binding the LTR enhancer, absolutely required for efficient HIV-1 replication.
18200030 First evidence of the involvement in malaria susceptibility of a specific locus within the 5q31 region of interferon regulatory factor-1.
18200030 Observational study of gene-disease association. (HuGE Navigator)
18084608 IRF-1 silencing through RNA interference, leads to an overexpression of TLR-4 in THP-1 cells.
18079498 functionally relevant IRF-1 (interferon regulatory factor 1) polymorphisms influence atopy risk, potentially by altering transcription factor binding, IRF-1 gene expression, and IFN-gamma regulation.
18079498 Observational study of gene-disease association. (HuGE Navigator)
17985330 IRF-1 activation regulates the induction of the IL-27p28 subunit by interferon beta.
17970693 The described IRF-1 promoter single nucleotide polymorphisms do not play a role in the pathogenesis of psoriasis or in influencing IFN-alpha-induced Th1 polarization.
17947510 These findings demonstrate for the first time that IRF-1 is a novel alternative GRbeta-independent mechanism mediating steroid dysfunction induced by pro-asthmatic cytokines.
17924060 These findings indicated that both the NF-kappaB and IRF-1 sites are required for the repression of promoter activity of IL-12 p40 by TGF-beta.
17918184 EGFR induces expression of IRF-1 via STAT1 and STAT3 activation leading to growth arrest of human cancer cells
17869652 Observational study of gene-disease association. (HuGE Navigator)
17869652 IRF-1 is a susceptibility gene for Behcet's disease (BD) in Korean BD patients; its polymorphisms are associated with thrombotic manifestations in BD patients.
17852336 population-based data of IRF-1 sequence contains 35 nucleotide additions, 8 nucleotide removals and another 12 nucleotide replacements compared to GenBank sequence L05072; and a single nucleotide difference was observed in the IRF-1 promoter sequence
17703412 Observational study of gene-disease association. (HuGE Navigator)
17617740 IFNalpha induces TRAIL expression via a STAT-1/IRF-1-dependent mechanism in human bladder cancer cells
17516545 These results confirm that by controlling RIG-I expression, IRF-1 plays an essential role in anti-viral immunity.
17498560 Observational study of genotype prevalence. (HuGE Navigator)
17498560 The A4396G single nucleotide polymorphism in IRF1 is more frequent in human breast cancer cell lines than in the general population and is more frequently expressed in African American than in Caucasian subjects.
17498560 Results show A4396G single nucleotide polymorphism in IRF1 gene is more frequently expressed in African American than in European ancestry subjects.
17328074 Observational study of gene-disease association. (HuGE Navigator)
17255955 KPNA2 is physically bound to IFN regulatory factor-1 (IRF-1), a transcription factor induced by IFN-gamma, induces nuclear translocation of IRF-1 in dermal fibroblasts
17213842 Observational study of gene-disease association. (HuGE Navigator)
17177148 Observational study of gene-disease association. (HuGE Navigator)
17016442 IRF-1 promotes rECM-mediated apoptosis and provide evidence that both rECM and rapid Tam signaling transcriptionally activate IRF-1 through recruitment of CBP to the IRF-1 GAS promoter complex.
16961714 Observational study of gene-disease association. (HuGE Navigator)
16944293 Observational study of gene-disease association. (HuGE Navigator)
16944293 no statistically significant association with susceptibility to persistent HBV infection was observed with the IFN-gamma, IFNGR-1 and 2, and IRF-1 gene polymorphisms under the codominant, dominant, and recessive models
16914093 Increase in IRF-1 expression, induced by IFNgamma and arsenic, correlates with both higher anti-proliferative effect and increased apoptosis.
16894313 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16894313 findings suggest the possibility that the -300AA IRF-1 genotype is associated with outcome in patients with hepatitis C virus genotype 3 infection; in HCV genotype-1-infected patients, this genotype appears associated with response to therapy
16857162 alternative splicing in exons 7, 8, and 9 is an important mechanism for negatively regulating IRF-1 in cervical cancer.
16703666 HIV-1 Vif downregulates the expression of interferon regulatory factor 1 (IRF1) in Vif-expression T cells
16679314 a novel repressor domain and differential gene regulation may contribute to IRF-1 tumor suppressor activity
16636311 Data suggest that the dual effect of retinoids in increasing interferon regulatory factor-1 mRNA and nuclear protein may be essential for its tumor suppressor activity and immunosurveillance functions in breast epithelial cells.
16512786 Intracellular HIV-1 Tat protein represses constitutive LMP2 transcription increasing proteasome activity by interfering with the binding of IRF-1 to STAT1
16512786 HIV-1 Vif downregulates the expression of interferon regulatory factor 1 (IRF1) in Vif-expression T cells
16483648 The expression of IRF-1 truncated mRNA and protein forms might be a critical event in the development of Myelodysplastic Syndrome.
16223733 STAT1, IRF1, and NF-kappaB activation and early myocyte apoptosis play a mechanistic role in septic myocardial depression and sepsis-induced organ dysfunction
16195814 Observational study of gene-disease association. (HuGE Navigator)
16195814 Individuals who were TT homozygous at IRF1 6477 T/G locus seemed to be attacked by Graves' disease much earlier than others.
16085646 all-trans-retinoic acid, an RARalpha ligand, regulates IFNgamma-induced IRF-1 by affecting multiple components of the IFNgamma signaling pathway, from the plasma membrane to the nuclear transcription factors
15907481 IRF-1 acts as a master regulator for the concerted expression of immunoproteasome components
15878912 Functional role for IRF-1 in the growth suppression of breast cancer cells and strongly implicate IRF-1 as a tumor suppressor gene in breast cancer that act to control apoptosis.
15863386 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15778351 TPO and IFN-gamma activate the expression of TAP1 via a new mechanism that involves functional cooperation between STAT1 and IRF-2 on the TAP1 promoter
15710386 p27Kip1 inhibits hTERT mRNA expression and telomerase activity through post-transcriptional up-regulation by IFN-gamma/IRF-1 signaling
15576464 the interferon signaling pathway and the human glucocorticoid receptor gene 1A promoter interact in T-lymphocytes
15560761 IFN-gamma-IRF system is involved in BPAG1 gene regulation in type-1 helper T-cell inflammatory skin conditions, such as psoriasis vulgaris
15548708 therapies designed to enhance IRF-1 expression within tumor cells may represent novel treatment strategies for breast cancer
15511228 IFN-gamma enhances TRAIL-induced apoptosis through IRF-1
15509808 IRF-1-p300 interface as an allosteric modifier of DNA-dependent acetylation of p53 at the p21 promoter
15489234 interleukin-12 p35 gene transcription is activated by interferon regulatory factor-1 and interferon consensus sequence-binding protein
15331704 IRF-1 is one of the key host factors that regulate intracellular HCV replication through modulation of interferon-stimulated-gene-mediated antiviral responses.
15265939 IFN regulatory factor 1 is involved in TNF-alpha-induced VCAM-1 expression and monocyte adhesion to TNF-alpha-activated endothelial cells.
15241475 a novel tumor necrosis factor (ligand) superfamily, member 10-mediated tumor suppressor activity of interferon regulatory factor 1 and suggest a mechanistic basis for the synergistic antitumor activities of certain retinoids and interferons
15226432 Results suggest that the functional interplay between interferon regulatory factors 1 and 2 serves as an elaborate and cooperative mechanism for regulation of interleukin-7 production essential for local immune regulation within human intestinal mucosa.
15173018 IRF-1 mediates the proapoptotic but not cell cycle arrest effects of the steroidal antiestrogen ICI 182,780
15078941 Measles virus upregulates IRF-1 in a manner that is independent of IFN but dependent on the JAK/STAT pathway. This induction of IRF-1 appears to suppress cell growth, although the extent seems to vary among MeV strains.
14993214 IRF1 has a role in up-regulation of human caspase-8 by interferon-gamma in breast tumor cells
14764039 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
14675396 Observational study of gene-disease association. (HuGE Navigator)
14675396 the IRF1 HinfI gene polymorphisms do not appear to be involved in susceptibility to celiac disease
14599866 Expression of IRF-1 is altered in human endometrioid adenocarcinoma compared with normal endometrium and postmenopausal endometrium.
12788988 These data indicate that interferon regulatory factor-1 is a hallmark of the gliadin-mediated inflammation in celiac disease.
12759449 IRF1 is one of the transcription factors responsible for the induced coexpression of NF-kappa B activator 1 (Act1) and CD40 in lung epithelial A549 cells by inflammatory cytokines.
12732645 IRF1 represses CDK2 gene expression by interfering with SP1-dependent transcriptional activation.
12711307 Identification of the domain of interferon regulatory factor-1 responsible for transactivation.
12677441 expression of IRF-1-dependent genes in neurons plays a role in ischemic neuronal death.
12545159 IRF-1 is a potential mediator of IFN-gamma-induced attenuation of telomerase activity and hTERT expression
12482935 IRF-1-CEBPbeta complex activate the promoter of IL-18 binding protein.
12479817 IRF-1 and IRF-2 induced by IFN-gamma bind to three distinct IL-4 promoter sites and function as transcriptional repressors
12433281 GRIM-19 protein inhibits the cell-transforming property of this protein via a physical interaction.
12420214 IRF-1 is controlled by two distinct signalling pathways; a JAK/STAT-signalling pathway in viral infected cells and an ATM-signalling pathway in DNA damaged cells.
12420205 Observational study of gene-disease association. (HuGE Navigator)
12191570 STAT-1, IRF-1, and RAR-beta expression were enhanced by IFN-gamma and ATRA in combination, and to a greater degree in BALM-3 cells than in BALM-1 cells, suggesting that these IFN-gamma related genes were involved in the induction of apoptosis.
12162881 Promoter single nucleotide polymorphisms were detected and their possible contribution to T-lymphocyte helper 1 response in chronic hepatitis C was studied. Interferon-beta therapy increased the CD4(+) cell population.
12115600 VCAM-1 expression via effects on interferon regulatory factor-1 expression and activity
12105194 Interferons inhibit tumor necrosis factor-alpha-mediated matrix metalloproteinase-9 activation via interferon regulatory factor-1 binding competition with NF-kappa B
12067985 IRF-1 associated with resistance to antiestrogens
11970993 IFN regulatory factor-1 regulates IFN-gamma-dependent cathepsin S expression
11948194 Host defense responses to infection by Mycobacterium tuberculosis. Induction of IRF-1 and a serine protease inhibitor
11909852 Isolation and characterization of a human STAT1 gene regulatory element. Inducibility by interferon (IFN) types I and II and role of IFN regulatory factor-1.
11846974 This review focuses on IRF-1 is a negative regulator of cell proliferation.
11846972 This review focuses on the induction and function of IRF-1 during M. tuberculosis infection
11804954 IFNtau effect on IRF-1 expression is primarily regulated by tyrosine-phosphorylated Stat1alpha or Stat1beta dimers
11721695 Review: Stimulation of interferon regulatory factor-1 by prolactin
11716756 IRF-1 exerts a pivotal role in granulocytic differentiation, and its induction by G-CSF represents a limiting step in the early events of myeloid cell differentiation.
11675348 HIV-1 Vif downregulates the expression of interferon regulatory factor 1 (IRF1) in Vif-expression T cells
11315919 Observational study of gene-disease association. (HuGE Navigator)
11240951 Observational study of gene-disease association. (HuGE Navigator)
11069564 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MPITRMRMRPWLEMQINSNQIPGLIWINKEEMIFQIPWKHAAKHGWDINKDACLFRSWAIHTGRYKAGEK      1 - 70
EPDPKTWKANFRCAMNSLPDIEEVKDQSRNKGSSAVRVYRMLPPLTKNQRKERKSKSSRDAKSKAKRKSC     71 - 140
GDSSPDTFSDGLSSSTLPDDHSSYTVPGYMQDLEVEQALTPALSPCAVSSTLPDWHIPVEVVPDSTSDLY    141 - 210
NFQVSPMPSTSEATTDEDEEGKLPEDIMKLLEQSEWQPTNVDGKGYLLNEPGVQPTSVYGDFSCKEEPEI    211 - 280
DSPGGDIGLSLQRVFTDLKNMDATWLDSLLTPVRLPSIQAIPCAP                             281 - 325
//

Text Mined References (234)

PMID Year Title
26872335 2016 Gene Regulatory Network Inference of Immunoresponsive Gene 1 (IRG1) Identifies Interferon Regulatory Factor 1 (IRF1) as Its Transcriptional Regulator in Mammalian Macrophages.
26674566 2016 The Transcription Factor Interferon Regulatory Factor-1 (IRF1) Plays a Key Role in the Terminal Effector Pathways of Human Preterm Labor.
26510961 2015 5-Azacytidine modulates interferon regulatory factor 1 in macrophages to exert a cardioprotective effect.
26362649 2015 Gene expression meta-analysis reveals immune response convergence on the IFN?-STAT1-IRF1 axis and adaptive immune resistance mechanisms in lymphoma.
26011589 2015 IRF-1 inhibits NF-?B activity, suppresses TRAF2 and cIAP1 and induces breast cancer cell specific growth inhibition.
25997853 2015 IFN Regulatory Factor-1 Modulates the Function of Dendritic Cells in Patients with Acute Coronary Syndrome.
25964490 2015 IRF-1 promotes liver transplant ischemia/reperfusion injury via hepatocyte IL-15/IL-15R? production.
25658920 2015 BANF1 is downregulated by IRF1-regulated microRNA-203 in cervical cancer.
25611806 2015 Interferon regulatory factor 1 and histone H4 acetylation in systemic lupus erythematosus.
25592039 2015 IFN-?-mediated IRF1/miR-29b feedback loop suppresses colorectal cancer cell growth and metastasis by repressing IGF1.
25576084 2015 Interferon regulatory factor-1 signaling regulates the switch between autophagy and apoptosis to determine breast cancer cell fate.
25501823 2014 Identification of IRF1 as critical dual regulator of Smac mimetic-induced apoptosis and inflammatory cytokine response.
25497010 2015 Restoration of IRF1-dependent anticancer effects by MEK inhibition in human cancer cells.
25418955 2015 Interferon regulatory factor 1 marks activated genes and can induce target gene expression in systemic lupus erythematosus.
25347735 2015 Oncogenic Ras inhibits IRF1 to promote viral oncolysis.
25312803 2014 The regulation role of interferon regulatory factor-1 gene and clinical relevance.
25014791 2014 Immunochip identifies novel, and replicates known, genetic risk loci for rheumatoid arthritis in black South Africans.
24995581 2014 Interferon regulatory factor 1 is an independent predictor of platinum resistance and survival in high-grade serous ovarian carcinoma.
24940638 2014 miR-31 dysregulation in cystic fibrosis airways contributes to increased pulmonary cathepsin S production.
24886089 2014 DTX3L and ARTD9 inhibit IRF1 expression and mediate in cooperation with ARTD8 survival and proliferation of metastatic prostate cancer cells.
24824216 2014 Genome-wide interaction studies reveal sex-specific asthma risk alleles.
24650050 2014 IRF-1 regulates alternative mRNA splicing of carcinoembryonic antigen-related cell adhesion molecule 1 (CEACAM1) in breast epithelial cells generating an immunoreceptor tyrosine-based inhibition motif (ITIM) containing isoform.
24632547 2014 The roles of interferon regulatory factors 1 and 2 in the progression of human pancreatic cancer.
24464131 2014 K63-linked polyubiquitination of transcription factor IRF1 is essential for IL-1-induced production of chemokines CXCL10 and CCL5.
24396068 2014 I?B kinase ? targets interferon regulatory factor 1 in activated T lymphocytes.
23969696 2013 Multiethnic meta-analysis of genome-wide association studies in >100 000 subjects identifies 23 fibrinogen-associated Loci but no strong evidence of a causal association between circulating fibrinogen and cardiovascular disease.
23934855 2013 Shear stress modulates VCAM-1 expression in response to TNF-? and dietary lipids via interferon regulatory factor-1 in cultured endothelium.
23811275 2013 IRF-1-binding site in the first intron mediates interferon-?-induced optineurin promoter activation.
23807161 2013 IRF-1 responsiveness to IFN-? predicts different cancer immune phenotypes.
23799084 2013 Interferon regulatory factor 1 polymorphisms previously associated with reduced HIV susceptibility have no effect on HIV disease progression.
23554911 2013 Up-regulation of intestinal epithelial cell derived IL-7 expression by keratinocyte growth factor through STAT1/IRF-1, IRF-2 pathway.
23487038 2013 BAL1/ARTD9 represses the anti-proliferative and pro-apoptotic IFN?-STAT1-IRF1-p53 axis in diffuse large B-cell lymphoma.
23378427 2013 Evidence for postinitiation regulation of mRNA biogenesis in tuberculosis.
23255602 2013 Smad7 protein induces interferon regulatory factor 1-dependent transcriptional activation of caspase 8 to restore tumor necrosis factor-related apoptosis-inducing ligand (TRAIL)-mediated apoptosis.
23226549 2012 Interferon-? upregulates expression of IFP35 gene in HeLa cells via interferon regulatory factor-1.
23134341 2013 DNA-binding regulates site-specific ubiquitination of IRF-1.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
23071666 2012 IRF1 and NF-kB restore MHC class I-restricted tumor antigen processing and presentation to cytotoxic T cells in aggressive neuroblastoma.
23046934 2012 [Expressions of OB-R, IRF-1 and GR-? in airway smooth muscle cells of obese rats with asthma].
23040881 2013 An association study of functional polymorphic genes IRF-1, IFNGR-1, and IFN-? with disease progression, aspartate aminotransferase, alanine aminotransferase, and viral load in chronic hepatitis B and C.
22879909 2012 Tagging single nucleotide polymorphisms in the IRF1 and IRF8 genes and tuberculosis susceptibility.
22874466 2012 IRF-1 and miRNA126 modulate VCAM-1 expression in response to a high-fat meal.
22401175 2012 Gene expression analysis of rheumatoid arthritis synovial lining regions by cDNA microarray combined with laser microdissection: up-regulation of inflammation-associated STAT1, IRF1, CXCL9, CXCL10, and CCL5.
22367195 2012 Interferon regulatory factor 1 transactivates expression of human DNA polymerase ? in response to carcinogen N-methyl-N'-nitro-N-nitrosoguanidine.
22345458 2012 C7L family of poxvirus host range genes inhibits antiviral activities induced by type I interferons and interferon regulatory factor 1.
22213332 2012 Interferon regulatory factor modulation underlies the bystander suppression of malaria antigen-driven IL-12 and IFN-? in filaria-malaria co-infection.
22200613 2012 Interferon Regulatory Factor 1 (IRF-1) induces p21(WAF1/CIP1) dependent cell cycle arrest and p21(WAF1/CIP1) independent modulation of survivin in cancer cells.
22139419 2011 New gene functions in megakaryopoiesis and platelet formation.
22096509 2011 Immune response and mitochondrial metabolism are commonly deregulated in DMD and aging skeletal muscle.
21834067 2011 Blocking of interferon regulatory factor 1 reduces tumor necrosis factor ?-induced interleukin-18 bioactivity in rheumatoid arthritis synovial fibroblasts by induction of interleukin-18 binding protein a: role of the nuclear interferon regulatory factor 1-NF-?B-c-jun complex.
21803131 2011 Genome-wide analysis of interferon regulatory factor I binding in primary human monocytes.
21790247 2011 Relation between IRF-1 gene and acute myelocytic leukemia in Kashmiri population.
21725055 2011 Chronic IFN-? production in mice induces anemia by reducing erythrocyte life span and inhibiting erythropoiesis through an IRF-1/PU.1 axis.
21683060 2011 BRG1 is indispensable for IFN-?-induced TRIM22 expression, which is dependent on the recruitment of IRF-1.
21586271 2011 Dual effects of HTLV-1 bZIP factor in suppression of interferon regulatory factor 1.
21411754 2011 HIV infection of dendritic cells subverts the IFN induction pathway via IRF-1 and inhibits type 1 IFN production.
21389130 2011 Human papillomavirus type 16 E5 protein induces expression of beta interferon through interferon regulatory factor 1 in human keratinocytes.
21300955 2011 Meta-analysis of genome-wide association studies in >80 000 subjects identifies multiple loci for C-reactive protein levels.
21288140 2011 The effect of gluten-free diet on Th1-Th2-Th3-associated intestinal immune responses in celiac disease.
21257209 2011 IRF-1 signaling in central nervous system glial cells regulates inflammatory demyelination.
21245151 2011 A multiprotein binding interface in an intrinsically disordered region of the tumor suppressor protein interferon regulatory factor-1.
21200019 2011 Epigenetic control of IRF1 responses in HIV-exposed seronegative versus HIV-susceptible individuals.
21102463 2010 Genome-wide meta-analysis increases to 71 the number of confirmed Crohn's disease susceptibility loci.
20980339 2011 Hepatitis B viraemia: its heritability and association with common genetic variation in the interferon gamma signalling pathway.
20947504 2011 Docking-dependent ubiquitination of the interferon regulatory factor-1 tumor suppressor protein by the ubiquitin ligase CHIP.
20861350 2010 Lysophosphatidic acid inhibits CC chemokine ligand 5/RANTES production by blocking IRF-1-mediated gene transcription in human bronchial epithelial cells.
20846942 2010 Functional relevance of the IRF-1 promoter polymorphism rs2549009 on transcriptional activity in a native genomic environment.
20817723 2010 Intracellular activation of interferon regulatory factor-1 by nanobodies to the multifunctional (Mf1) domain.
20588308 2010 Dengue hemorrhagic fever is associated with polymorphisms in JAK1.
20533260 2010 [Role of the interferon-stimulated response elements I/II in expression regulation of the retinoic acid induced gene G].
20525893 2010 Mechanisms of IL-12 synthesis by human dendritic cells treated with the chemical sensitizer NiSO4.
20503287 2010 Interleukin-9 polymorphism in infants with respiratory syncytial virus infection: an opposite effect in boys and girls.
20485362 2010 Association analysis of susceptibility candidate region on chromosome 5q31 for tuberculosis.
20459687 2010 Candidate malaria susceptibility/protective SNPs in hospital and population-based studies: the effect of sub-structuring.
20457620 2010 IFNgamma restores breast cancer sensitivity to fulvestrant by regulating STAT1, IFN regulatory factor 1, NF-kappaB, BCL2 family members, and signaling to caspase-dependent apoptosis.
20435892 2010 Activation of IL-27 p28 gene transcription by interferon regulatory factor 8 in cooperation with interferon regulatory factor 1.
20177960 2010 Inhibition of IFN regulatory factor-1 down-regulate Th1 cell function in patients with acute coronary syndrome.
20177805 2010 Central nervous system expression of interferon regulatory factor 1 regulates experimental autoimmune encephalomyelitis.
20049431 2010 Regulation of immunity and oncogenesis by the IRF transcription factor family.
20031577 2009 Novel loci, including those related to Crohn disease, psoriasis, and inflammation, identified in a genome-wide association study of fibrinogen in 17 686 women: the Women's Genome Health Study.
20031576 2009 Association of novel genetic Loci with circulating fibrinogen levels: a genome-wide association study in 6 population-based cohorts.
19880820 2010 Human rhinovirus-induced epithelial production of CXCL10 is dependent upon IFN regulatory factor-1.
19858727 2010 Disease progression from chronic hepatitis C to cirrhosis and hepatocellular carcinoma is associated with repression of interferon regulatory factor-1.
19851330 2010 IRF-1 transcriptionally upregulates PUMA, which mediates the mitochondrial apoptotic pathway in IRF-1-induced apoptosis in cancer cells.
19845895 2009 Fine mapping of the CELIAC2 locus on chromosome 5q31-q33 in the Finnish and Hungarian populations.
19805480 2010 Glucocorticoid receptor interacting protein-1 restores glucocorticoid responsiveness in steroid-resistant airway structural cells.
19697121 2010 Frequent loss of heterozygosity at the interferon regulatory factor-1 gene locus in breast cancer.
19692168 2010 Genetic susceptibility to distinct bladder cancer subphenotypes.
19642896 2009 GAGE, an antiapoptotic protein binds and modulates the expression of nucleophosmin/B23 and interferon regulatory factor 1.
19625176 2009 PTEN identified as important risk factor of chronic obstructive pulmonary disease.
19593445 2009 Expression of the Bcl-2 protein BAD promotes prostate cancer growth.
19574175 2009 Interaction between interferon regulatory factor-1 and human papillomavirus E7 oncogene in cervical cancer: an ontology study.
19548631 2009 Differential gene expression profiles of lung epithelial cells exposed to Burkholderia pseudomallei and Burkholderia thailandensis during the initial phase of infection.
19536153 2009 Sex-specific effect of IL9 polymorphisms on lung function and polysensitization.
19502235 2009 Cooperative regulation of the interferon regulatory factor-1 tumor suppressor protein by core components of the molecular chaperone machinery.
19463200 Asthma persistence versus progression: does airway smooth muscle function predict irreversible airflow obstruction?
19450680 2009 Role of the IRF-1 enhancer domain in signalling polyubiquitination and degradation.
19433065 2009 Types I and II interferons upregulate the costimulatory CD80 molecule in monocytes via interferon regulatory factor-1.
19428110 2009 IRF-1 and p65 mediate upregulation of constitutive HLA-A antigen expression by hepatocellular carcinoma cells.
19426920 2009 Expression of interferon regulatory factor 1, 3, and 7 in primary Sjögren syndrome.
19404407 2009 Type I interferons and interferon regulatory factors regulate TNF-related apoptosis-inducing ligand (TRAIL) in HIV-1-infected macrophages.
19345417 2009 The ambiguous role of interferon regulatory factor-1 (IRF-1) immunoexpression in myelodysplastic syndrome.
19295429 2009 Gene-environmental interaction in the development of atopic asthma: new developments.
19258923 2009 Genetic susceptibility to respiratory syncytial virus bronchiolitis in preterm children is associated with airway remodeling genes and innate immune genes.
19247692 2009 Analyses of associations with asthma in four asthma population samples from Canada and Australia.
19170196 2009 Polymorphisms in innate immunity genes and lung cancer risk in Xuanwei, China.
19145247 2009 Lack of association of interferon regulatory factor 1 with severe malaria in affected child-parental trio studies across three African populations.
19131452 2009 Genetic association study for RSV bronchiolitis in infancy at the 5q31 cytokine cluster.
19129219 2009 A ChIP-chip approach reveals a novel role for transcription factor IRF1 in the DNA damage response.
19056926 2009 c-Jun N-terminal kinase (JNK1) upregulates XIAP-associated factor 1 (XAF1) through interferon regulatory factor 1 (IRF-1) in gastrointestinal cancer.
19028144 2009 No evidence for association between the interferon regulatory factor 1 (IRF1) gene and clinical tuberculosis.
19012493 2009 Common variants in immune and DNA repair genes and risk for human papillomavirus persistence and progression to cervical cancer.
18986693 2009 Nitric oxide inhibits human rhinovirus-induced transcriptional activation of CXCL10 in airway epithelial cells.
18694960 2008 CD40 induces antigen transporter and immunoproteasome gene expression in carcinomas via the coordinated action of NF-kappaB and of NF-kappaB-mediated de novo synthesis of IRF-1.
18688264 2009 FOXA1 and IRF-1 intermediary transcriptional regulators of PPARgamma-induced urothelial cytodifferentiation.
18678606 2008 Regulation of STAT pathways and IRF1 during human dendritic cell maturation by TNF-alpha and PGE2.
18676680 2008 Pathway-based evaluation of 380 candidate genes and lung cancer susceptibility suggests the importance of the cell cycle pathway.
18655181 2008 Characterization of the 5'-flanking region and regulation of expression of human anion exchanger SLC26A6.
18641303 2008 IFN regulatory factor-1 negatively regulates CD4+ CD25+ regulatory T cell differentiation by repressing Foxp3 expression.
18497060 2008 IRF-1 promotes apoptosis in p53-damaged basal-type human mammary epithelial cells: a model for early basal-type mammary carcinogenesis.
18454680 2008 Genetic basis for adverse events after smallpox vaccination.
18401423 2008 Tie2-R849W mutant in venous malformations chronically activates a functional STAT1 to modulate gene expression.
18381204 2008 KAP1 regulates type I interferon/STAT1-mediated IRF-1 gene expression.
18338947 2008 Multiple sclerosis and hepatitis C virus infection are associated with single nucleotide polymorphisms in interferon pathway genes.
18316378 2008 Leishmania major infection activates NF-kappaB and interferon regulatory factors 1 and 8 in human dendritic cells.
18216101 2008 IRF-1 is required for full NF-kappaB transcriptional activity at the human immunodeficiency virus type 1 long terminal repeat enhancer.
18200030 2008 Interferon regulatory factor-1 polymorphisms are associated with the control of Plasmodium falciparum infection.
18084608 2007 RNA interference of interferon regulatory factor-1 gene expression in THP-1 cell line leads to Toll-like receptor-4 overexpression/activation as well as up-modulation of annexin-II.
18079498 2008 IRF-1 gene variations influence IgE regulation and atopy.
18035482 2008 Regulation of XAF1 expression in human colon cancer cell by interferon beta: activation by the transcription regulator STAT1.
17985330 2007 IFN-beta modulates the response to TLR stimulation in human DC: involvement of IFN regulatory factor-1 (IRF-1) in IL-27 gene expression.
17970693 2007 Polymorphisms in the interferon regulatory factor-1 promoter are not associated with psoriasis and do not influence IFN-alpha-induced Th1 polarization.
17947510 2008 Cytokines induce an early steroid resistance in airway smooth muscle cells: novel role of interferon regulatory factor-1.
17942705 2007 Elevated level of SUMOylated IRF-1 in tumor cells interferes with IRF-1-mediated apoptosis.
17924060 2008 Suppression of NF-kappaB and IRF-1-induced transcription of the murine IL-12 p40 by transforming growth factor-beta Smad pathway in macrophages.
17918184 2008 EGFR induces expression of IRF-1 via STAT1 and STAT3 activation leading to growth arrest of human cancer cells.
17869652 2007 Associations between interferon regulatory factor-1 polymorphisms and Behçet's disease.
17852336 2008 Human interferon regulatory factor-1 gene and its promoter sequences revealed by population-based complete gene sequencing.
17703412 2007 Genetic susceptibility to respiratory syncytial virus bronchiolitis is predominantly associated with innate immune genes.
17617740 2007 Interferon-alpha induces TRAIL expression and cell death via an IRF-1-dependent mechanism in human bladder cancer cells.
17516545 2007 Central role of interferon regulatory factor-1 (IRF-1) in controlling retinoic acid inducible gene-I (RIG-I) expression.
17498560 2007 The A4396G polymorphism in interferon regulatory factor 1 is frequently expressed in breast cancer cell lines.
17328074 2007 No evidence for genetic association of interferon regulatory factor 1 in juvenile idiopathic arthritis.
17255955 2007 Differential regulation of karyopherin alpha 2 expression by TGF-beta1 and IFN-gamma in normal human epidermal keratinocytes: evident contribution of KPNA2 for nuclear translocation of IRF-1.
17213842 2007 Refined genomic localization and ethnic differences observed for the IBD5 association with Crohn's disease.
17177148 2006 Analysis of MxA, IL-4, and IRF-1 genes in Filipino patients with subacute sclerosing panencephalitis.
17121613 2006 Mapping of nine porcine interferon regulatory factor genes.
17016442 2007 Interferon regulatory factor-1 regulates reconstituted extracellular matrix (rECM)-mediated apoptosis in human mammary epithelial cells.
16961714 2006 Association of interferon-gamma and interferon regulatory factor 1 polymorphisms with asthma in a family-based association study in Taiwan.
16944293 2006 Genetic polymorphism of interferon-gamma, interferon-gamma receptor, and interferon regulatory factor-1 genes in patients with hepatitis B virus infection.
16932750 2006 IRFs: master regulators of signalling by Toll-like receptors and cytosolic pattern-recognition receptors.
16914093 2006 Arsenic enhances the apoptosis induced by interferon gamma: key role of IRF-1.
16894313 2006 Interferon regulatory factor-1 promoter polymorphism and the outcome of hepatitis C virus infection.
16857162 2006 Alternative splicing variants of IRF-1 lacking exons 7, 8, and 9 in cervical cancer.
16679314 2006 A novel repressor domain is required for maximal growth inhibition by the IRF-1 tumor suppressor.
16636311 2006 Retinoic acid exerts dual regulatory actions on the expression and nuclear localization of interferon regulatory factor-1.
16512786 2006 Intracellular HIV-1 Tat protein represses constitutive LMP2 transcription increasing proteasome activity by interfering with the binding of IRF-1 to STAT1.
16483648 2006 Aberrant alternative splicing of interferon regulatory factor-1 (IRF-1) in myelodysplastic hematopoietic progenitor cells.
16223733 2005 Human serum from patients with septic shock activates transcription factors STAT1, IRF1, and NF-kappaB and induces apoptosis in human cardiac myocytes.
16195814 2005 Association study between the IL4, IL13, IRF1 and UGRP1 genes in chromosomal 5q31 region and Chinese Graves' disease.
16085646 2005 Physiological and receptor-selective retinoids modulate interferon gamma signaling by increasing the expression, nuclear localization, and functional activity of interferon regulatory factor-1.
15907481 2005 IRF-1 mediates upregulation of LMP7 by IFN-gamma and concerted expression of immunosubunits of the proteasome.
15878912 2005 Interferon regulatory factor-1 (IRF-1) exhibits tumor suppressor activities in breast cancer associated with caspase activation and induction of apoptosis.
15863386 2005 Contribution of Irf-1 promoter polymorphisms to the Th1-type cell response and interferon-beta monotherapy for chronic hepatitis C.
15778351 2005 IFN regulatory factor-2 cooperates with STAT1 to regulate transporter associated with antigen processing-1 promoter activity.
15710386 2005 IFN-gamma/IRF-1-induced p27kip1 down-regulates telomerase activity and human telomerase reverse transcriptase expression in human cervical cancer.
15576464 2005 Interaction between the interferon signaling pathway and the human glucocorticoid receptor gene 1A promoter.
15560761 2004 Transcriptional regulation of the 230-kDa bullous pemphigoid antigen gene expression by interferon regulatory factor 1 and interferon regulatory factor 2 in normal human epidermal keratinocytes.
15548708 2004 Ectopic expression of interferon regulatory factor-1 promotes human breast cancer cell death and results in reduced expression of survivin.
15511228 2004 IFN-gamma enhances TRAIL-induced apoptosis through IRF-1.
15509808 2004 Interferon regulatory factor 1 binding to p300 stimulates DNA-dependent acetylation of p53.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15489234 2004 Synergistic activation of interleukin-12 p35 gene transcription by interferon regulatory factor-1 and interferon consensus sequence-binding protein.
15331704 2004 Regulation of hepatitis C virus replication by interferon regulatory factor 1.
15265939 2004 Phenyl methimazole inhibits TNF-alpha-induced VCAM-1 expression in an IFN regulatory factor-1-dependent manner and reduces monocytic cell adhesion to endothelial cells.
15241475 2004 Tumor suppressor IRF-1 mediates retinoid and interferon anticancer signaling to death ligand TRAIL.
15226432 2004 Interferon regulatory factor 1 (IRF-1) and IRF-2 distinctively up-regulate gene expression and production of interleukin-7 in human intestinal epithelial cells.
15173018 2004 interferon regulatory factor-1 mediates the proapoptotic but not cell cycle arrest effects of the steroidal antiestrogen ICI 182,780 (faslodex, fulvestrant).
15078941 2004 Growth arrest of epithelial cells during measles virus infection is caused by upregulation of interferon regulatory factor 1.
14993214 2004 The up-regulation of human caspase-8 by interferon-gamma in breast tumor cells requires the induction and action of the transcription factor interferon regulatory factor-1.
14764039 Gene-gene and gene-environmental interactions of p53, p21, and IRF-1 polymorphisms in Korean women with cervix cancer.
14675396 2003 IL12B and IRF1 gene polymorphisms and susceptibility to celiac disease.
14599866 2003 Interferon regulatory factor-1 expression in human uterine endometrial carcinoma.
12788988 2003 Enhanced expression of interferon regulatory factor-1 in the mucosa of children with celiac disease.
12759449 2003 IFN regulatory factor-1 is required for the up-regulation of the CD40-NF-kappa B activator 1 axis during airway inflammation.
12732645 2003 The tumor suppressor interferon regulatory factor 1 interferes with SP1 activation to repress the human CDK2 promoter.
12711307 2003 Functional dissection of the transactivation domain of interferon regulatory factor-1.
12677441 2003 Interferon regulatory factor-1 immunoreactivity in neurons and inflammatory cells following ischemic stroke in rodents and humans.
12545159 2003 Interferon regulatory factor-1 (IRF-1) is a mediator for interferon-gamma induced attenuation of telomerase activity and human telomerase reverse transcriptase (hTERT) expression.
12482935 2002 The promoter of IL-18 binding protein: activation by an IFN-gamma -induced complex of IFN regulatory factor 1 and CCAAT/enhancer binding protein beta.
12479817 2002 IFN-gamma represses IL-4 expression via IRF-1 and IRF-2.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12433281 2002 Characterization of monoclonal antibodies against GRIM-19, a novel IFN-beta and retinoic acid-activated regulator of cell death.
12420214 2002 Regulation of the IRF-1 tumour modifier during the response to genotoxic stress involves an ATM-dependent signalling pathway.
12420205 2002 Polymorphisms of transforming growth factor-beta1 and transforming growth factor-beta1 type II receptor genes are associated with acute graft-versus-host disease in children with HLA-matched sibling bone marrow transplantation.
12191570 2002 Human B-cell lymphoma cell lines are highly sensitive to apoptosis induced by all-trans retinoic acid and interferon-gamma.
12162881 2002 The detection of IRF-1 promoter polymorphisms and their possible contribution to T helper 1 response in chronic hepatitis C.
12115600 2002 Hyperosmotic stimuli inhibit VCAM-1 expression in cultured endothelial cells via effects on interferon regulatory factor-1 expression and activity.
12105194 2002 Interferons inhibit tumor necrosis factor-alpha-mediated matrix metalloproteinase-9 activation via interferon regulatory factor-1 binding competition with NF-kappa B.
12067985 2002 Association of interferon regulatory factor-1, nucleophosmin, nuclear factor-kappaB, and cyclic AMP response element binding with acquired resistance to Faslodex (ICI 182,780).
11909852 2002 Isolation and characterization of a human STAT1 gene regulatory element. Inducibility by interferon (IFN) types I and II and role of IFN regulatory factor-1.
11846974 2002 IRF-1 as a negative regulator of cell proliferation.
11846972 2002 IRF and tuberculosis.
11846971 2002 Activities of IRF-1.
11804954 2002 Roles of Stat1, Stat2, and interferon regulatory factor-9 (IRF-9) in interferon tau regulation of IRF-1.
11721695 2001 Stimulation of interferon regulatory factor-1 by prolactin.
11716756 2001 Ectopic expression of interferon regulatory factor-1 potentiates granulocytic differentiation.
11559933 2001 Alterations in IRF1/IRF2 expression in acute myelogenous leukemia.
11483597 2001 SHP1 protein-tyrosine phosphatase inhibits gp91PHOX and p67PHOX expression by inhibiting interaction of PU.1, IRF1, interferon consensus sequence-binding protein, and CREB-binding protein with homologous Cis elements in the CYBB and NCF2 genes.
11315919 2001 Cytokine gene polymorphisms and susceptibility to juvenile idiopathic arthritis. British Paediatric Rheumatology Study Group.
11304541 2001 Coactivator p300 acetylates the interferon regulatory factor-2 in U937 cells following phorbol ester treatment.
11244049 2001 IRF family of transcription factors as regulators of host defense.
11240951 2001 Association of IFN-gamma and IFN regulatory factor 1 polymorphisms with childhood atopic asthma.
11069564 2000 Mutation screening of interferon regulatory factor 1 gene (IRF-1) as a candidate gene for atopy/asthma.
10764778 2000 Adenovirus E1A down-regulates LMP2 transcription by interfering with the binding of stat1 to IRF1.
10702232 2000 Inactivation of interferon regulatory factor-1 tumor suppressor protein by HPV E7 oncoprotein. Implication for the E7-mediated immune evasion mechanism in cervical carcinogenesis.
10438822 1999 Functional analysis of human herpesvirus 8-encoded viral interferon regulatory factor 1 and its association with cellular interferon regulatory factors and p300.
10395927 1999 Interferon regulatory factor 1 tryptophan 11 to arginine point mutation abolishes DNA binding.
10357819 1999 The role of HMG I(Y) in the assembly and function of the IFN-beta enhanceosome.
10094406 1999 A role for casein kinase II phosphorylation in the regulation of IRF-1 transcriptional activity.
10022868 1999 The histone acetylase PCAF is a phorbol-ester-inducible coactivator of the IRF family that confers enhanced interferon responsiveness.
9865487 Role of the interferon regulatory factors (IRFs) in virus-mediated signaling and regulation of cell growth.
9865486 The role of interferon regulatory factors in the interferon system and cell growth control.
9742224 1998 Functional domains of interferon regulatory factor I (IRF-1).
9679752 1998 Functionally inactivating point mutation in the tumor-suppressor IRF-1 gene identified in human gastric cancer.
8746784 1995 NF kappa B and interferon regulatory factor 1 physically interact and synergistically induce major histocompatibility class I gene expression.
8438156 1993 Deletion of IRF-1, mapping to chromosome 5q31.1, in human leukemia and preleukemic myelodysplasia.
7768900 1995 Functional domain analysis of interferon consensus sequence binding protein (ICSBP) and its association with interferon regulatory factors.
7507207 1994 Structure and regulation of the human interferon regulatory factor 1 (IRF-1) and IRF-2 genes: implications for a gene network in the interferon system.
3409321 1988 Regulated expression of a gene encoding a nuclear factor, IRF-1, that specifically binds to IFN-beta gene regulatory elements.
2726461 1989 Sequence of a cDNA coding for human IRF-1.
2475256 1989 Structurally similar but functionally distinct factors, IRF-1 and IRF-2, bind to the same regulatory elements of IFN and IFN-inducible genes.
1680796 1991 Assignment of the human interferon regulatory factor-1 (IRF1) gene to chromosome 5q23-q31.
1382447 1992 Human interferon regulatory factor 1: intron-exon organization.