Property Summary

NCBI Gene PubMed Count 12
PubMed Score 58.95
PubTator Score 25.68

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
juvenile dermatomyositis 1189 1.9e-14
acute quadriplegic myopathy 1157 1.7e-08
ovarian cancer 8491 9.0e-03
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0

Expression

  Differential Expression (3)

Disease log2 FC p
juvenile dermatomyositis 1.123 1.9e-14
acute quadriplegic myopathy 1.238 1.7e-08
ovarian cancer 1.300 9.0e-03

Gene RIF (5)

PMID Text
26220098 importin alpha8 functions as a cNLS receptor with distinct cargo specificity, and that heterodimerization by importin alpha8 is a novel regulatory mode of cNLS binding, in addition to the autoinhibitory regulation by the importin beta binding domain.
23906023 Knockdown of IPO8 reduced the amount of nuclear p65 following TNF stimulation. IPO8 binding to p65 is NLS independent.
19167051 Study provides evidence that Imp8 is required for cytoplasmic miRNA-guided gene silencing and affects nuclear localization of Ago proteins.
19014639 IPO8 is the most accurate reference gene for clinical lung specimens.
18519565 TGF-beta-induced and basal state spontaneous nuclear import of Smad4 require importin 7 and 8.

AA Sequence

MDLNRIIQALKGTIDPKLRIAAENELNQSYKIINFAPSLLRIIVSDHVEFPVRQAAAIYLKNMVTQYWPD      1 - 70
REPPPGEAIFPFNIHENDRQQIRDNIVEGIIRSPDLVRVQLTMCLRAIIKHDFPGHWPGVVDKIDYYLQS     71 - 140
QSSASWLGSLLCLYQLVKTYEYKKAEEREPLIIAMQIFLPRIQQQIVQLLPDSSYYSVLLQKQILKIFYA    141 - 210
LVQYALPLQLVNNQTMTTWMEIFRTIIDRTVPPETLHIDEDDRPELVWWKCKKWALHIVARLFERYGSPG    211 - 280
NVTKEYFEFSEFFLKTYAVGIQQVLLKILDQYRQKEYVAPRVLQQAFNYLNQGVVHSITWKQMKPHIQNI    281 - 350
SEDVIFSVMCYKDEDEELWQEDPYEYIRMKFDIFEDYASPTTAAQTLLYTAAKKRKEVLPKMMAFCYQIL    351 - 420
TDPNFDPRKKDGALHVIGSLAEILLKKSLFKDQMELFLQNHVFPLLLSNLGYLRARSCWVLHAFSSLKFH    421 - 490
NELNLRNAVELAKKSLIEDKEMPVKVEAALALQSLISNQIQAKEYMKPHVRPIMQELLHIVRETENDDVT    491 - 560
NVIQKMICEYSQEVASIAVDMTQHLAEIFGKVLQSDEYEEVEDKTVMAMGILHTIDTILTVVEDHKEITQ    561 - 630
QLENICLRIIDLVLQKHVIEFYEEILSLAYSLTCHSISPQMWQLLGILYEVFQQDCFEYFTDMMPLLHNY    631 - 700
VTIDTDTLLSNAKHLEILFTMCRKVLCGDAGEDAECHAAKLLEVIILQCKGRGIDQCIPLFVQLVLERLT    701 - 770
RGVKTSELRTMCLQVAIAALYYNPDLLLHTLERIQLPHNPGPITVQFINQWMNDTDCFLGHHDRKMCIIG    771 - 840
LSILLELQNRPPAVDAVVGQIVPSILFLFLGLKQVCATRQLVNREDRSKAEKADMEENEEISSDEEETNV    841 - 910
TAQAMQSNNGRGEDEEEEDDDWDEEVLEETALEGFSTPLDLDNSVDEYQFFTQALITVQSRDAAWYQLLM    911 - 980
APLSEDQRTALQEVYTLAEHRRTVAEAKKKIEQQGGFTFENKGVLSAFNFGTVPSNN                 981 - 1037
//

Text Mined References (19)

PMID Year Title
26220098 2015 Functional characterization of importin ?8 as a classical nuclear localization signal receptor.
23906023 2013 KPNB1, XPO7 and IPO8 mediate the translocation ofNF-?B/p65 into the nucleus.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19167051 2009 Importin 8 is a gene silencing factor that targets argonaute proteins to distinct mRNAs.
19014639 2008 Identification of importin 8 (IPO8) as the most accurate reference gene for the clinicopathological analysis of lung specimens.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18519565 2008 Preferential utilization of Imp7/8 in nuclear import of Smads.
17932509 2007 Proteomic and functional analysis of Argonaute-containing mRNA-protein complexes in human cells.
17903295 2007 Genetic correlates of longevity and selected age-related phenotypes: a genome-wide association study in the Framingham Study.
16541075 2006 The finished DNA sequence of human chromosome 12.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11682607 2001 Signal recognition particle protein 19 is imported into the nucleus by importin 8 (RanBP8) and transportin.
10737800 2000 Shotgun sequencing of the human transcriptome with ORF expressed sequence tags.
9214382 1997 A novel class of RanGTP binding proteins.