Property Summary

NCBI Gene PubMed Count 26
PubMed Score 25.57
PubTator Score 9.20

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
Multiple myeloma 1.365 4.7e-04
psoriasis 1.100 9.5e-04
glioblastoma multiforme 1.100 2.9e-16
group 3 medulloblastoma 1.300 1.9e-03
atypical teratoid / rhabdoid tumor 1.200 1.2e-04
medulloblastoma, large-cell 1.400 2.7e-03
primitive neuroectodermal tumor 1.700 2.5e-04
fibroadenoma 1.100 4.0e-02
subependymal giant cell astrocytoma -1.060 1.1e-02
inflammatory breast cancer -2.000 7.0e-07
Pick disease -1.500 1.5e-04
progressive supranuclear palsy -1.300 1.1e-02
ulcerative colitis -1.200 2.9e-07
ovarian cancer -2.500 4.5e-13

 GWAS Trait (1)

Protein-protein Interaction (4)

Gene RIF (8)

PMID Text
24956979 An alpha-helical pair and a rare, two-turn 310 helix, that together form a substrate-binding pocket of IP6K2.
23322705 FGF2-signaling involves the inositol polyphosphate cascade, including inositol hexakisphosphate kinase (IP6K), and demonstrate that IP6K1,2 regulates Runx2 and osteoblast gene expression.
22446964 Genetic polymorphisms in IP6K2 gene is associated with autoimmune disease.
21262846 Casein kinase-2 mediates cell survival through phosphorylation and degradation of inositol hexakisphosphate kinase-2.
21078964 Gene disruption of IP6K2 in colorectal cancer cells selectively impairs p53-mediated apoptosis, instead favoring cell-cycle arrest. IP6K2 acts by binding directly to p53 and decreasing expression of proarrest gene targets
17379600 IHPK2-TRAF2 binding leads to attenuation of TAK1- and NF-kappaB-mediated signaling and is partially responsible for the apoptotic activity of IHPK2.
15533939 InsP6K2 is a physiologic mediator of cell death
11896621 IHPK2 over expression enhances sensitivity of ovarian carcinoma cells to radiation, IFN-beta, caspase 8 and DR4

AA Sequence

MSPAFRAMDVEPRAKGVLLEPFVHQVGGHSCVLRFNETTLCKPLVPREHQFYETLPAEMRKFTPQYKGVV      1 - 70
SVRFEEDEDRNLCLIAYPLKGDHGIVDIVDNSDCEPKSKLLRWTTNKKHHVLETEKTPKDWVRQHRKEEK     71 - 140
MKSHKLEEEFEWLKKSEVLYYTVEKKGNISSQLKHYNPWSMKCHQQQLQRMKENAKHRNQYKFILLENLT    141 - 210
SRYEVPCVLDLKMGTRQHGDDASEEKAANQIRKCQQSTSAVIGVRVCGMQVYQAGSGQLMFMNKYHGRKL    211 - 280
SVQGFKEALFQFFHNGRYLRRELLGPVLKKLTELKAVLERQESYRFYSSSLLVIYDGKERPEVVLDSDAE    281 - 350
DLEDLSEESADESAGAYAYKPIGASSVDVRMIDFAHTTCRLYGEDTVVHEGQDAGYIFGLQSLIDIVTEI    351 - 420
SEESGE                                                                    421 - 426
//

Text Mined References (28)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25082827 2014 A genome-wide association study identifies a novel locus at 6q22.1 associated with ulcerative colitis.
24956979 2014 IP6K structure and the molecular determinants of catalytic specificity in an inositol phosphate kinase family.
23322705 2013 The regulation of runt-related transcription factor 2 by fibroblast growth factor-2 and connexin43 requires the inositol polyphosphate/protein kinase C? cascade.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
22446964 2012 Genetics of gene expression in primary immune cells identifies cell type-specific master regulators and roles of HLA alleles.
21262846 2011 Casein kinase-2 mediates cell survival through phosphorylation and degradation of inositol hexakisphosphate kinase-2.
21078964 2010 p53-mediated apoptosis requires inositol hexakisphosphate kinase-2.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17379600 2007 Effect of inositol hexakisphosphate kinase 2 on transforming growth factor beta-activated kinase 1 and NF-kappaB activation.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15533939 2005 Inositol hexakisphosphate kinase-2, a physiologic mediator of cell death.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11502751 2001 Identification and characterization of a novel inositol hexakisphosphate kinase.
11337497 2001 Inositol hexakisphosphate kinase 2 mediates growth suppressive and apoptotic effects of interferon-beta in ovarian carcinoma cells.
10827188 2000 The inositol hexakisphosphate kinase family. Catalytic flexibility and function in yeast vacuole biogenesis.
10574768 1999 Synthesis of diphosphoinositol pentakisphosphate by a newly identified family of higher inositol polyphosphate kinases.
9776982 1998 Localization of PiUS, a stimulator of cellular phosphate uptake to human chromosome 3p21.3.
9110174 1997 Large-scale concatenation cDNA sequencing.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8619474 1996 A "double adaptor" method for improved shotgun library construction.