Property Summary

NCBI Gene PubMed Count 531
PubMed Score 285.22
PubTator Score 2867.06

Knowledge Summary

Patent (33,607)

TINX Plot

  Disease (9)

Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Polycystic Ovary Syndrome 334 4.349 2.2
Gout 93 0.0 2.0
Retinal disease 16 0.0 1.0
Disease Target Count Z-score Confidence
Donohue Syndrome 6 5.599 2.8

Expression

  Differential Expression (21)

Disease log2 FC p
pancreatic cancer -1.400 2.8e-03
Multiple myeloma 1.672 1.2e-02
malignant mesothelioma 1.700 9.2e-08
astrocytoma 2.200 7.1e-03
ependymoma -1.100 2.5e-03
esophageal adenocarcinoma 1.800 2.2e-02
psoriasis -2.700 9.8e-06
osteosarcoma -2.019 2.3e-04
atypical teratoid / rhabdoid tumor -1.200 3.9e-03
glioblastoma -1.400 3.5e-03
medulloblastoma, large-cell -2.200 5.8e-06
primary pancreatic ductal adenocarcinoma -1.341 4.3e-03
intraductal papillary-mucinous adenoma (... -1.300 1.6e-02
intraductal papillary-mucinous neoplasm ... -1.400 2.7e-02
Breast cancer 2.900 3.7e-02
adult high grade glioma -1.200 3.5e-03
primary Sjogren syndrome -1.500 4.0e-04
pancreatic carcinoma 1.100 3.0e-02
spina bifida -1.577 4.7e-02
ovarian cancer -1.200 8.4e-04
dermatomyositis 1.600 8.9e-05

MLP Assay (2)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448
652206 other 0 / 0 / 0 ML-187 activity in a kinase panel for Extended probe characterization for beta-cell apoptosis Measured in Biochemical System

Gene RIF (282)

PMID Text
27172637 results indicate a significant correlation between T132903C and C109869T single nucleotide polymorphisms in the insulin receptor and solute carrier family 6 member 14 amino acid transporter (SLC6A14) genes with idiopathic infertility in Persian males
26874853 A novel insertion/deletion (indel) mutation was found in INSR gene.
26862994 Data indicate that a highly specific qRT-PCR assay to quantify levels of the insulin-like growth factor receptor and insulin receptor isoforms (IR-A, IR-B, and IGF-1R) on the same scale to provide a critical diagnostic and predictive tool.
26850678 Given the limited number of patients treated with KW-2450 in our study, it is not possible to make a meaningful comparison of efficacy with other IGF-1R/IR dual kinases inhibitors
26760116 Low-oxygen tension can modify the IGF-1 or IGF-2 signaling via the IGF-1R and IR in placental mesenchymal stem cells.
26721804 C1008T SNP at exon 17 of INSR is associated with insulin resistance in Indian women with polycystic ovarian syndrome.
26584640 mTORC2 promotes rapamycin- and ligand-induced type I insulin-like growth factor receptor / insulin receptor phosphorylation.
26438154 remarkable therapeutic window observed for BI 885578 is achieved by virtue of the distinctive pharmacokinetic properties of the compound capitalizing on the physiologic mechanism of glucose homeostasis and differential levels of IGF1R and INSR expression
26406954 The results demonstrate an increased IR-A:IR-B ratio in all clinical stages of breast cancer
26297026 Down-regulation of IR and IGF1R, achieved by insulin + fructose and monoclonal antibody treatments, results in decreased downstream signaling.
26263910 Study provides evidence that IR, irrespective of isoform type, mediates primary resistance to IGF-IR-targeted therapy and can be used as a potential biomarker for patient selection.
26251103 INSR (rs1799816) polymorphism conferred risk towards T2D in Brahmins.
26160152 novel nonsense mutations are associated with reduced expression of the mature INSR beta-subunit, which was most likely due to impaired proreceptor processing
26113601 Non-small cell lung cancer cell survival crucially depends on functional insulin receptors
26089371 The INSR rs2059806 SNP is associated with small for gestational age pregnancies.
26077721 Three SNPs of the INSR, rs2059807, s8109559 and rs919275, were significantly associated with obesity-related cancers (p value < 0.02) with the most significantly associated SNP being rs2059807 (p value = 0.008).
26063811 only Ptprj was co-expressed with the IR in major insulin target tissues : the skeletal muscle, liver and adipose tissue. the activation of IR and Akt by insulin was enhanced, and glucose and insulin tolerance was improved in Ptprj-deficient mice
25867326 rs2059806 of INSR was associated with both type 2 diabetes mellitus and type 2 diabetic nephropathy, while rs7212142 of mTOR was associated with type 2 diabetic nephropathy but not type 2 diabetes mellitus in a Chinese Han population.
25758790 The insulin receptor and IGF1 receptor kinase domains are functional dimers in the activated state.
25753915 A disease entity of adult-onset hyperinsulinemic hypoglycemia syndrome associated with mutations in INSR gene.
25742416 Data revitalizes the role of the INSR isoforms in the pathogenesis of type 2 diabetes mellitus, and suggests that an abrogated INSRB:A ratio that favors the INSRA isoform may negatively impact insulin-mediated metabolic signalling.
25687571 Insulin receptor (IR) signaling and endocytosis are regulated by AMPK,enzyme of purine de novo synthesis pathway ATIC,putative tyrosine phosphatase PTPLAD1. IR/PTPLAD1/ATIC/AMPK form a complex within the plasma membrane and Golgi/endosome.ATIC deletion increases AMPK-Thr172 phosphorylation.Both ATIC and PTPLAD1 affect IR tyrosine phosphorylation.With AICAR, they regulate insulin mediated translocation of Glut2 in HEK 293.
25622255 The rs2059807 could be a promising candidate SNP that might be involved in the development of Polycystic ovary syndrome.
25604425 It is reported here that both splice variants of insulin/IGF1 receptor hybrids are activated by IGF1 with >20-fold higher potency than insulin.
25557790 found significant associations between other variants of the INSR gene and colorectal cancer risk
25516545 Data suggest that PBEF/NAMPT (nicotinamide phosphoribosyltransferase) inhibits insulin/insulin receptor beta (IR) signaling via PBEF/NAMPT-dependent promotion of IR translocation into non-raft domains of lung epithelial cell membrane.
25458098 Results suggest INSR CT or TT genotype carriers have an increased risk for developing refractory temporal lobe epilepsy
25351985 studied whether the reversal of gestational diabetes mellitus effects on transport by insulin depends on restoration of insulin receptor-A expression
25102778 Determining the amount of phosphorylated insulin receptor could thus represent a novel prognostic/predictive tool in colorectal adenocarcinoma patients.
25017244 Our work provides evidence supporting a link between IGFIR and IR isoform expression levels and colorectal adenoma risk.
24973425 MET, HER3, IGF1R, and INSR pathways activation represent novel mechanism underlying lapatinib unresponsiveness in HER2+ gastric cancer. Combination strategy may be recommended in treating patients with HER2+ gastric cancer with these pathways activation
24970814 Data indicate that engineered ubiquitin ligase is an effective therapeutic strategy for the treatment of the cancers with co-expressed insulin receptor/insulin-like growth factor receptor (IR/IGF-1R).
24939305 Data indicate that changes in tyrosine phosphorylation of insulin receptor (InsR) are associated with insulin resistance (IR) in patients with gestational diabetes mellitus (GDM)
24867955 These results show that IR can be activated through a pathway that bypasses its canonical ligand-binding domain.
24809298 Overexpression of INSR increased cell proliferation, colony formation, migration, invasion and resistance to apoptosis in prostate cancer.
24711643 CUL7, OBSL1 and CCDC8 modulate the alternative splicing of the INSR
24683100 Different insulin receptor family expression levels were measured in six cancer cell lines.
24679227 Data suggest that insulin/insulin receptor signaling plays pivotal roles in differentiation, function, and survival of osteoblasts; osteoblastic insulin signaling is also required for energy metabolism. [REVIEW]
24583283 Insulin-induced phosphorylation of the insulin receptor is dependent on Neu1 sialidase activity.
24568043 study concluded that the His 1058 C/T polymorphism at the tyrosine kinase domain of the INSR gene had a relationship to the pathogenesis of lean polycystic ovary syndrome patients in a Japanese population
24535599 Grb14-insulin receptor interaction is regulated in part by GSK-3 activity.
24529663 REVIEW: focuses on the expression and function of insulin, IGFs and their receptors in the brain in physiological and pathological conditions.
24508798 Findings show that in vitro model could be useful for determining the molecular mechanism underlying insulin receptor (IR) cleavage.
24468607 A novel heterozygous mutation of the insulin receptor gene (INSR) was identified in this family with with type A insulin resistance syndrome
24277691 Protective effects of breastfeeding are reflected in higher expression levels of SLC27A2, FASN, PPARalpha and INSR in blood cells.
24175768 INSR (rs1052371) was not associated with colorectal cancer risk in an Iranian cohort.
24127567 The impact of insulin on different cell types in the intestinal epithelium might differ depending on relative IR-B IR-A expression levels.
24078630 LMBD1 plays an imperative role in mediating and regulating the endocytosis of the IR.
23950881 Data indicate that insulin receptor isoformA (IR-A) mRNA was differentially expressed in four endometrial carcinoma cell lines.
23697264 this study did not find an association between VNTR INS, C/T INSR and Gly792Arg IRS-1 polymorphism and susceptibility to polycystic ovary syndrome or insulin resistance in Croatian women with PCOS
23666741 Data suggest that the distinct fiber type involvement in DM1 and DM2 muscle tissues would not be related to qualitative differences in the expression of insulin receptor gene (INSR).
23633480 A mechanism responsible for the generation of mitogenic IR-A via a novel interplay between IR and EGFR pathways in hepatocellular carcinoma.
23395167 the LRP6(R611C) mutation diminishes TCF7L2-dependent transcription of the IR while it increases the stability of IGFR and enhances mTORC1 activity.
23386514 Indinavir and nelfinavir inhibit proximal insulin receptor signaling and salicylate abrogates inhibition: potential role of the NFkappa B pathway
23363253 Results of this study demonstrated the dependence of INSR and related to insulin receptor signaling gene expressions in U87 glioma cells on ERN1 enzyme function indicating its participation in the regulation of metabolic and proliferative processes via endoplasmic reticulum stress which is important component of tumor growth and metabolic diseases.
23348915 Using all-atom structural models this work endeavored to understand the conformational reorganization of insulin on binding to its receptor in the presence of a recently resolved critical tandem hormone-binding element, the CT-peptide.
23303383 INSR rs1366600, ACSL1 rs2292899 and FABP2 rs11724758 could influence the susceptibility to type 2 diabetes in Chinese Han population, most likely through their effects on the specific miRNA-binding sites.
23302862 presentation of the first view of the interaction of insulin with its primary binding site on the insulin receptor, on the basis of four crystal structures of insulin bound to truncated insulin receptor constructs
23251408 Insulin receptor isoform A to B ratio was significantly higher in cancer as well as in tumor adjacent benign prostate tissue compared to purely benign prostates
23190452 Studies indicate that insulin receptor (IR) and IGF Type 1 Receptor (IGFR) have been identified as important partners of Grb10/14 and SH2B1/B2 adaptors.
23059533 study reports that expression of the insulin receptor in kidney is altered during diabetes; a strong expression in proximal and distal tubules from renal cortex, and a significant reduction in type 2 diabetic patients was detected
23018458 Group B streptococci-induced formation of polymorphonuclear leukocyte function is specifically downmodulated by insulin via insulin receptor-mediated induction of phosphatidylinositol 3-kinase.
22982059 Data suggest that only a fraction of circulating insulin-like activity is due to insulin itself; serum IGF-I and IGF-II may substantially contribute to insulin receptor signaling.
22971162 Data from normally cycling young women suggest that expression of INSR (and glucose transporter 1) in endometrium is higher in luteal/secretory phase (compared to follicular phase) and is localized to stromal cells (compared to epithelial cells).
22879999 The nuclear localization and function of the IGF-1R/INSR (Hybrid-R) and the role of IGF-1/IGF-1R and Hybrid-R signaling in the human corneal epithelium.
22825921 Human cardiac microvascular endothelial cells express more IGF1Rs than IRs, and mainly react to IGF1 due to the predominance of IGF1Rs and insulin/IGF1 hybrid receptors.
22775283 The "T" allele of the His1085His polymorphism in the INSR gene shows significant protection against diabetes. This study gains importance because there are no data available to date on the role of INSR variants in T2D in the Indian population.
22768670 Mutation of the insulin receptor gene in a preterm infant is associated with Donohue syndrome and heart failure
22705438 genetic association studies in Chinese populations: Data suggest that subjects carrying N2 allele of exon 8 of INSR are at higher risk for metabolic syndrome if they are of Han ethnicity and at higher risk for hypertension if of Han or Yi ethnicity.
22629383 This study provides evidence that IR secretion is increased in HIV-seropositive women, and increased IR secretion is associated with cognitive impairment in these women.
22590634 Extracellular nucleotides inhibit insulin receptor signaling, stimulate autophagy and control lipoprotein secretion.
22541124 Insulin promotes the proliferation of Reh cells. High expression levels of IR and IGF-IR may be closely related with the growth of leukemia cells.
22534794 In this study, we investigated 31 SNPs across the INSR gene and identified a novel SNP of rs17254521 in intron 2 which is associated with hypertension.
22466604 the fine regulation of the expression of different isoforms of insulin receptor(IR) during osteogenic differentiation confirms the important role played by IR in bone homeostasis
22438913 both IGF1R and IR were N-linked glyosylated in figitumumab-sensitive cells
22404968 Studies indicate that PTP1B and TCPTP act together in vitro and in vivo to regulate insulin receptor (IR) signaling and glucose homeostasis.
22318726 insulin evoked significant IR-A internalization, a process modestly affected by IGF-II
22278734 co-association of LDLR with IR and their dissociation by insulin may be an important part of the regulatory mechanism of the normal physiological receptor function in a biological system.
22278432 Data suggest that INSR, leptin receptor (LEPR), and carnitine palmitoyltransferase 1A (CPT1A) mRNA levels are higher in blood cells/blood from overweight children compared with normal weight children; INSR and CPT1A are increased only in males.
22189999 Despite tenfold elevated fasting insulin and marked insulin resistance in Arg1174Gln insulin receptor carriers, the levels of total adiponectin, leptin, IGFBP1 and IGFBP2 are similar to those observed in controls.
22161861 Data support the concept for dual IGF-1R/IR targeting in hepatocellular carcinoma (HCC).
22140505 These data provide evidence that human beta- and alpha-cells can enter the cell-cycle, but proliferation of beta-cells in type 2 diabetes mellitus fails due to G1-to-S phase arrest secondary to defective insulin signaling.
22140443 This study has therefore lead to a greater understanding of the mechanisms of IGF-II binding and activation of the IGF-1R and IR-A.
22132154 These data point to a functional interaction between hnRNP F and SRSF1 as a mutant that eliminates SRSF1 binding to exon 11, or a SRSF1 knockdown, which prevents the stimulatory effect of hnRNP F over expression.
22099628 complexes could mediate crosstalk among STATs, estrogen receptor beta (ERbeta), and AP-1 regulating the ERbeta-mediated transcriptional repression of the hIR gene and insulin resistance in U-937 cells
22082268 The placental lectins reduced the binding of insulin and to IR in a dose-dependent manner.
22081023 Met stimulates hepatocyte glucose uptake through crosstalk with insulin receptor.
22046260 the mRNA levels of IR-B were significantly decreased in tumors. The IR-A:IR-B ratio was significantly higher in luminal B breast cancer than in luminal A.
22017372 Biallelic c.433 C>T (p.R118C) mutation of INSR causes significant damage to insulin binding and insulin-mediated signal transduction
21913804 higher INSR-A and lower INSR-B contribute to higher proliferation and lower metabolic response. Thus, differential expression of INSR isoforms represents a potential biological link between breast cancer and diabetes.
21908557 A kinome-wide siRNA screen showed that the insulin receptor is required for growth of MCF-7 cells resistant to long-term estrogen deprivation.
21869538 The A1028V mutaion is associated with a decrease in expression of the insulin receptor, potentially accounting for its loss of function.
21838706 Thus the results of the present study provide a structural insight into the mechanism of the regulation of insulin receptor binding by exon 11
21680660 These findings indicate that IR-A activation by IGF-II elicits a unique signaling pathway that may play a distinct role in physiology and in disease.
21645371 No significant evidence of association or linkage was found in the four tested markers, indicating that our family samples did not support susceptibility of the INSR gene to PCOS.
21602145 Partial methylation of the INSR gene occurs in the endometria of polycystic ovary syndrome patients, but this study does not provide a strong evidence supporting the relationship between insulin resistance and INSR gene methylation in women with PCOS.
21535266 IGF1 might inhibit insulinogenic differentiation of HEAC, whereas IGF2 enhances differentiation, and enhancement of IGF2 appears to be mediated via IR
21524684 insulin and IGF-I activate their cognate receptors and IGF-I also activates naturally occuring IGF-I/insulin hybrid receptors (HR) IGF-II activates insulin receptor, IGF-I receptor and HR
21487008 PTP1B plays a crucial role in the control of the activity of the IR precursor during its biosynthesis. In addition, this new substrate-trapping mutant may be a valuable tool for the identification of new PTP1B substrates.
21410323 in breast cancer cells, IGF-2 activates ER-alpha and ER-beta, and modulates their translocation to nucleus, membrane organelles and mitochondria; IGF-2 actions are mediated by IGF-1R and insulin receptor
21346174 The findings provide direct evidence for a functional interaction between CB1R and IR signaling involved in the regulation of beta-cell proliferation.
21318406 The p.Ile119Met INSR appears to have arisen around the Horn of Africa, and should be sought first in severely insulin resistant patients with ancestry from this region
21300347 A pathway-based tagging SNP approach allowed us to identify novel INSR SNPs associated with PCOS, one of which confirmed association in a large replication cohort.
21204696 INSR H1085H C>T polymorphism seems to be associated with prostate cancer risk.
21177763 Studies provide a clear biological rationale to test anti-IGF-IR/InsR therapy in combination with chemotherapy in patients with TNBC.
21139137 Studies indicate that insulin, IGF-1, TrkA, and TrkC receptors as trophic and as dependence receptors.
21123448 Our data suggest that IR isoforms and IGF-I receptor play a role in the biology of follicular thyroid precursors
21113646 rs3745551 located in 3'-UTR of the INSR is associated with insulin resistant phenotype
21082232 Observational study of gene-disease association. (HuGE Navigator)
20971123 Observational study of gene-disease association. (HuGE Navigator)
20857837 Observational study of gene-disease association. (HuGE Navigator)
20855565 Observational study of gene-disease association. (HuGE Navigator)
20849815 these results identify a novel aspect in the crosstalk between insulin receptor and GPCR signaling systems in pancreatic cancer cells.
20734064 Observational study of gene-disease association. (HuGE Navigator)
20674666 These results suggest that the PKD family is involved in the transcriptional regulation of the InsR gene.
20634197 Meta-analysis of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20624623 our findings suggest that increased expression of the IR is a consequence of epileptic seizures and a cause of intractable epilepsy
20620597 hybrid insulin/IGF-I receptor (hybrid-R), which is present in endometrial carcinoma cells, may have an important role in mediating IGF- and insulin-induced cell growth and in preventing apoptosis.
20602615 Observational study of gene-disease association. (HuGE Navigator)
20568733 insulin binds the IR in two distinct phases:where the initial binding is fast and relates to insulin site 2, and a subsequent, conformational change involving insulin site 1 and the IR site 1 constitutes the second slower phase.
20521171 Case Report: loss of NPC1 function, with attendant changes in membrane cholesterol composition, does not significantly modify the insulin resistance phenotype, even in the context of severely impaired INSR function.
20493471 Association of insulin receptor genetic variants with polycystic ovary syndrome in european women.
20493471 Observational study of gene-disease association. (HuGE Navigator)
20468064 Observational study of gene-disease association. (HuGE Navigator)
20421297 Study revealed that insulin receptor endocytosis is necessary for two identified feedback mechanisms involving mass and information transfer.
20416077 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20360006 IR and IGF1R act as identical portals to the regulation of gene expression, with differences between insulin and IGF-1 effects due to a modulation of the amplitude of the signal created by the specific ligand-receptor interaction
20348418 analysis of a tandem hormone-binding element in the insulin receptor
20339196 a nonsense mutation causing premature termination after amino acid 331 in the alpha subunit of the insulin receptor was identified in Japanese diabetes patients.
20200332 Observational study of gene-disease association. (HuGE Navigator)
20068229 Stduies indicate that cGMP-dependent protein kinase I modulates the RhoA-ROCK pathway and insulin receptor signaling to elicit BAT differentiation and stimulate thermogenesis.
20009360 findings indicate that TNF-alpha induces a loss of sensitivity to stimulation by IGF-I, through reducing amount of IGF-I/insulin hybrid receptor and the stimulation of HR tyrosine kinase activity by IGF-I.
19996272 Studies show that BMS-754807 is a reversible inhibitor of the insulin-like growth factor 1 receptor/insulin receptor and increases poly ADP ribose polymerase and Caspase 3 cleavage
19950604 The autophosphorylation of insulin receptors decreases in polycystic ovary syndrome patients.
19948975 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and genetic testing. (HuGE Navigator)
19926323 The association of insulin receptor (IotaNSR) and insulin receptor substrates (IRSs) polymorphisms with the risk of developing polycystic ovary syndrome, was investigated.
19926323 Meta-analysis of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19898946 This study provides the first demonstration that serum deprivation may not be sufficient, and G0/G1 synchronization may be required to obtain optimal responsiveness of hIR-overexpressing cell lines.
19835884 Taken together, these findings suggest that the structural movements within the receptor upon ligand binding are small and are possibly limited to local rotation of domains.
19817984 insulin action on platelet function in platelets expressing hybrid Insulin/IGF-1 receptors
19815552 LRP1 mediates anti-apoptotic function in neurons by regulating insulin receptor and the Akt survival pathway
19720790 Likely digenic cause of insulin resistance and growth deficiency resulting from the combined heterozygous disruption of INSR and CHN2, implicating CHN2 for the first time as a key element of proximal insulin signaling in vivo.
19692168 Observational study of gene-disease association. (HuGE Navigator)
19688022 The lack of similar mutation records in literature and genetic data banks may suggest a geographic pattern for these INSR gene variants in our population.
19688022 Observational study of gene-disease association. (HuGE Navigator)
19654240 the 5'-UTR of the mRNA encoding human insulin receptor contains a functional internal ribosome entry segment.
19625176 Observational study of gene-disease association. (HuGE Navigator)
19578796 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19575708 At least partially overlapping signaling pathways are essential for the development of normal rod photoreceptors in IR transgenic mice.
19560451 Data show that ICT-EIA for sIRalpha may be useful as a good marker for evaluating diabetes risk.
19541767 cellular levels of IR are down-regulated in obesity as well as in obese fat tissues.
19459609 A thermodynamic study of ligand binding to the first three domains of the human insulin receptor.
19406747 dysfunctions of brain insulin and IGF-1 receptors contribute to Abeta aggregation and subsequent synaptic loss
19387820 Observational study of gene-disease association. (HuGE Navigator)
19326042 RNA for the insulin-independent IR-A isoform was significantly increased and appeared related to the fibre-type composition in the majority of the myotonic dystrophy cases examined.
19246519 Results show that leptin and insulin receptors are strongly up-regulated in placentas of hydatidiform mole and abortion, and suggest that they may be candidates for the endocrine control of human pregnancy.
19219452 IR-beta levels were unchanged from the resting levels after both exercise trials in deltoid
19211708 Significant association of C/T polymorphism at His1058 of INSR with PCOS in the lean rather than obese Indian women.
19211708 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19170714 R1174 of the IR gene may be a candidate locus for hyperinsulinaemic hypoglycaemia.
19170196 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19139090 Val(43), Phe(28), and Val(14) (equivalent to site 1) are critical to IGF-1R and IR binding, whereas mutation to alanine of Gln(18) affects only IGF-1R and not IR
19135752 Two sisters with heterozygous mutations in the insulin receptor gene associated with mild glucose intolerance.
19064572 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
19051206 An analysis of some of these sequences shows that TCR from both human diabetics and NOD mice mimic insulin, glucagon, the insulin receptor, and the glucagon receptor.
19047369 SRp20, SF2/ASF, and CUG-BP1 act antagonistically to regulate IR alternative splicing in vivo and that the relative ratios of SRp20 and SF2/ASF to CUG-BP1 in different cells determine the degree of exon inclusion.
18996102 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18991400 Insulin interacts in trans with two receptor binding sites to generate high-affinity interactions.
18925540 the PTPase activity in patients with insulin receptor gene mutation and severe insulin resistance may differ from that in ordinary type 2 diabetes
18834871 testosterone and 17beta-estradiol can directly enhance insulin receptor mRNA expression, insulin binding and glucose oxidation in Chang liver cells and thereby glucose metabolism
18828733 Observational study of gene-disease association. (HuGE Navigator)
18785179 observations document the presence of insulin receptors on primary human prostate cancers
18767165 Crystal structures for inhibitor-kinase complexes in which the inhibitor has different binding orientations and hydrogen-bonding patterns with extracellular-signal regulated kinase 2 and insulin receptor tyrosine kinase, are reported.
18716398 Observational study of gene-disease association. (HuGE Navigator)
18711691 The role of the IGF/insulin receptors in cervical cancer cell lines with different Human papillomavirus (HPV) status, SiHa (HPV positive), and C33a (HPV negative), was assessed.
18708119 Microvascular endothelial cells are sensitive to IGF-I but resistant to insulin due to a preponderance of IGF-I receptors and sequestration of insulin receptors into insulin/IGF-I hybrid receptors.
18693051 IR and IGF-IR are present in human preadipocytes and adipocytes. Differentiation is characterized by an increased IR/IGF-IR ratio.
18676680 Observational study of gene-disease association. (HuGE Navigator)
18660489 Observational study of gene-disease association. (HuGE Navigator)
18616667 Competitive equilibrium binding assays revealed significantly reduced specific binding to the insulin, IGF-I, and IGF-II and their receptors in both the anterior cingulate and vermis of alcoholic human brains.
18556968 autoimmunity to insulin receptors may be causal in insulin resistance syndrome especially for females with ovarian hyperandrogenism, and that IR-ab may be found in insulin resistance syndrome besides those previously defined by the type B phenotype
18535540 reduced adipose tissue lipoprotein lipase expression, being significantly correlated with the decrease in insulin and prolactin, suggests a role of hyperinsulinemia and hyperprolactinemia in inducing and sustaining obesity.
18455362 The first replication study for the reported association of the insulin receptor gene (INSR) with migraine with aura was perfoermed.
18455362 Observational study of gene-disease association. (HuGE Navigator)
18348886 Corosolic acid may exert its antidiabetic effects by enhancing insulin receptor phosphorylation.
18318661 differential gene expression of insulin receptor in cells, by insulin and S597
18249389 Polymorphism in postinsulin receptor signaling pathway is not associated with polycystic ovary syndrome.
18048361 24 insulin analogues and four IGF analogues were expressed and analyzed to explore the role of amino acid differences in the A- and B-domains between insulin and the IGFs in binding affinity for the insulin receptor
17965293 Partial DNA sequences of defective insulin receptor gene in two sisters with elevatetd plasma adiponectin and leptin levels.
17957771 compositions of the glycans were determined
17925406 despite binding equipotency, insulin, and S597 initiate different signaling and biological responses through the same insulin receptor isoform
17914103 Observational study of gene-disease association. (HuGE Navigator)
17914103 Carrying the variant allele of the IRS1 Gly972Arg SNP further decreased the risk for colorectal cancer among the INSR-603G allele carriers.
17855343 physiologically relevant levels of naturally secreted Abeta interfere with insulin receptor function in hippocampal neurons and prevent the rapid activation of specific kinases required for long term potentiation
17854350 Insulin receptor serine kinase, PSD-95, and the Kv1.3 potassium channel co-localize to regulate membrane excitability and synaptic transmission at critical locations in the olfactory bulb.
17658524 Among the analyzed single nucleotide polymorphisms (SNPs), +176477 C>T, a novel SNP in the INSR gene, was associated with the pathogenesis of polycystic ovary syndrome in a Korean population.
17577576 These data indicate that IR is a tyrosine kinase receptor, which undergoes PS/gamma-secretase-dependent processing.
17563366 CALR and Hsp90 stabilize INSR.
17563065 increased soluble insulin receptor ectodomain level appears to be a more rapid glycemic marker than A1C or glycoalbumin
17556377 These results demonstrate that the InsR regulates choriocarcinoma cell invasion through activation by IGF-II.
17475934 provide evidence for a mechanism of adiponectin resistance and corroborate the notion that adiponectin potentiates hepatic insulin sensitivity
17434141 Since HMGA1 regulates IR promoter activity, expression of IR gene was impaired causing reduction of IR on cell surface and that compromises with insulin sensitivity.
17416760 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17374711 PPAR-gamma, insulin receptor with its signaling pathways, and StAR protein constitute a novel human ovarian regulatory system with complex interactions among its components
17348446 Observational study of gene-disease association. (HuGE Navigator)
17344070 Insulin uptake & dose-response experiments toward activation of downstream signal transduction molecules demonstrated that presence of intact hIR-JM domain which harbors the NPEY motif is essential for Shc phosphorylation but not for IRS-1 phosphorylation
17340225 the regulation of glucose uptake, proliferation, and type I collagen production by visfatin in human osteoblasts involves IR phosphorylation, the same signal-transduction pathway used by insulin
17325037 Data show that IGF-1 acts through insulin receptors to preferentially activate insulin receptor substrate 2 (IRS-2) , but not IRS-1.
17275003 Observational study of gene-disease association. (HuGE Navigator)
17229154 Alpha 1,3-fucosyltransferase-VII regulates the signaling molecules of the insulin receptor pathway
17221153 High levels of insulin receptor expression in early stage breast cancers is independently and significantly associated with more favorable clinical outcomes.
17102568 APS-mediated ubiquitination of the IR induced enhancement of the IR internalization, but did not affect the IR degradation.
17078079 6 sites of mucin-type O-glycosylation were found at residues T744, T749, S757, S758, T759, & T763 in a 20-residue segment lacking secondary structure, followed by residues 765-770, the mAb 18-44 epitope.
17001305 These data suggest a role for the IR, but not the IGF-IR, in KSHV-induced transformation of vascular ECs.
16962112 Differential expression of insulin receptor, IGF-IR, and IGF-I in adhesion fibroblasts may contribute to pathogenesis of fibrosis in diabetic patients.
16946708 coordinated physical and functional interactions between hnRNP H, CUG-BP1 and MBNL1 dictate IR splicing in normal and DM1 myoblasts
16831875 Data show that hybrid receptors formed by insulin receptor (IR) and insulin-like growth factor I receptor (IGF-IR) have low insulin and high IGF-1 affinity irrespective of the IR splice variant.
16814253 These data strongly suggest that these domains contain an insulin binding site.
16806206 Observational study of gene-disease association. (HuGE Navigator)
16806206 C/T polymorphism in exon 17 of the INSR gene is not associated with susceptibility of polycystic ovary syndrome in a Korean population.
16761106 Impaired insulin clearance in part rescues in vivo insulin signalling in muscle in these carriers of a mutant INSR by increasing insulin action on the non-mutated insulin receptors
16510536 Results led to a conclusion that the novel T/C SNP at codon Cys1008 of INSR is associated with decreased insulin sensitivity in Chinese women with polycystic ovary syndrome.
16473310 In conclusion, this study detected no INSR mutations in affected members of a chromosome 19 linked migraine pedigree. Hence, migraine linkage to this chromosomal region may involve other candidate genes.
16314505 3-phosphoinositide-dependent protein kinase 1 (PDK1) directly binds to the insulin receptor, followed by PDK-1 activation and insulin metabolic effects.
16137651 Receptor binding studies indicate that alpha-PGG binds to the IR and affects the binding between insulin and IR by reducing the maximum binding of insulin to IR without significantly altering the binding affinity of insulin to IR.
16084832 activation of T-cells with development of insulin receptors in hyperglycemic conditions may serve as a mechanism for control of glucose entry into these cells and protect them against glucose toxicity
15938783 Polymorphism in exon 17 of insulin receptor leads to increased risk of insulin resistance in women with polycystic ovary syndrome.
15938783 Observational study of gene-disease association. (HuGE Navigator)
15862945 Transcriptional repression of the human insulin receptor gene mediated by estrogen receptor beta in U-937 cells.
15799978 analysis of insulin receptor functional insulin binding epitopes
15745246 Observational study of gene-disease association. (HuGE Navigator)
15715521 This study provides evidence to suggest cross down-regulation of leptin and insulin receptors at both receptor and downstream signalling levels.
15708546 This study suggests an association between the affinity of insulin receptors and number of IGF-1 receptors with placental and/or fetal growth.
15694368 Our findings suggest, for the first time, that AMPK activation could reduce the expression of insulin receptor, at least in part, by a down-regulation of the transcriptional level, and this effect may be liver specific.
15590636 the G972R naturally occurring polymorphism of IRS-1 not only reduces phosphorylation of the substrate but allows IRS-1 to act as an inhibitor of the insulin receptor kinase, producing global insulin resistance
15582274 Observational study of gene-disease association. (HuGE Navigator)
15581831 Observational study of gene-disease association. (HuGE Navigator)
15563471 Molecular modeling of the IRK domain indicated that the ATP-binding site becomes distorted after releasing the nucleotide unless the IRK domain is oxidatively derivatized at Cys1245.
15498182 Observational study of gene-disease association. (HuGE Navigator)
15485753 Increased systolic and diastolic blood pressure, heart rate, plasma insulin, and decreased erythrocyte insulin receptors preexist in healthy offspring of patients with essential hypertension.
15240646 Mrna elevated in polycystic ovary syndrome. Granulosa cell insulin receptor heterogeneity, together with adiposity-dependent intrafollicular insulin availability, is novel mechanism by which insulin may affect granulosa cell function within follicle.
15233842 The exon-definition model explains alternative splicing of exon 11 in the insulin receptor gene in-vivo but not in-vitro.
15205474 The C and D domains of IGF-II promote higher affinity binding to the IR-A than the equivalent domains of IGF-I.
15182363 Data show that in adipocytes the insulin receptor is localized to caveolae,and that part of insulin receptor substrate 1 (IRS1), the immediate downstream signal mediator, colocalizes with the insulin receptor in the plasma membrane and caveolae.
15161766 Linkage analysis and mutation screening revealed missense mutation (Arg1174Gln) in tyrosine kinase domain of insulin receptor gene that cosegregated with disease phenotype.
15114529 Insulin receptor splicing alteration is associated with myotonic dystrophy type 2
15061947 Observational study of gene-disease association. (HuGE Navigator)
14722023 Human micro- and macrovascular endothelial cells express more IGF-I receptor than insulin receptor.
14693412 Observational study of gene-disease association. (HuGE Navigator)
14693412 None of the polymorphisms in INSR or IRS1 was associated with metabolic syndrome findings.
14551916 Observational study of gene-disease association. (HuGE Navigator)
12881524 INSR-A, the predominant isoform in fetal tissues and malignant cells, binds with a high affinity insulin and IGF-II, which differentially regulate gene expression.
12878213 Fibroblasts from leprechaunism patients with mutant insulin receptors have altered gene expression.
12850828 the presence of a free heavy chain IgG in the circulation from spinal cord-injured subjects blocked insulin receptor binding sites and also blocked the prostacyclin receptor interaction in platelets; insulin-induced NO synthesis was markedly impaired.
12738810 High glucose impairs insulin secretion by affecting insulin receptor expression, splicing, and signaling in islets of Langerhans.
12734206 Interaction of filamin A with the insulin receptor alters insulin-dependent activation of the mitogen-activated protein kinase pathway.
12732844 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
12711007 the human insulin receptor gene promoter has a vitamin D response element
12665574 HMGI-Y physically interacts with Sp1 and C/EBP beta and facilitates the binding of both factors to the insulin receptor promoter
12654724 This protein is activated both by human and Caenorhabditis elegans insulin.
12634852 dynamics of the interaction between this receptor and protein tyrosine-phosphatase 1B in living cells
12613967 Cornea and conjunctiva express insulin receptor in cytoplasm of epithelium.
12612081 The IR may serve as a cellular substrate for both protein tyrosine phosphatase forms TC48 and TC45. Differentially localized variants of TCPTP may dephosphorylate the IR and downregulate insulin-induced signaling in vivo.
12575209 Observational study of gene-disease association. (HuGE Navigator)
12538626 Donohue's syndrome (leprechaunism) was found to be homozygous for an in-frame trinucleotide deletion within the insulin receptor gene resulting in the deletion of valine 335.
12493740 inhibition of insulin-stimulated insulin receptor substrate (IRS)-phosphatidylinositol 3-kinase/Akt signaling pathway by disrupting the association of IRS-1/IRS-2 with the insulin receptor
12477518 Observational study of gene-disease association. (HuGE Navigator)
12477518 A C/T single nucleotide polymorphism at the tyrosine kinase domain of the insulin receptor gene is associated with polycystic ovary syndrome.
12420346 Observational study of gene-disease association. (HuGE Navigator)
12270939 alanine-scanning mutagenesis of the insulin receptor A and B isoforms has identified several new side chains contributing to insulin binding and indicates that the energetic contributions of certain side chains differ in each
12193537 insulin receptor may play a role in the regulation of ovarian cancer cell growth
12138094 Insulin-IGF1 hybrid receptors have different tissue-specific responses based on their isoforms
12125099 Transactivation of INSR by calcitrol
12112020 Sam68 associates with the SH3 domains of Grb2 recruiting GAP to the Grb2-SOS complex in insulin receptor signaling
12107746 an arginine to cysteine(252) mutation from a patient with severe insulin resistance inhibits receptor internalisation but preserves signalling events
12031977 cross-sectional data suggest a role of physiological concentration of fasting plasma adiponectin in the regulation of skeletal muscle IR tyrosine phosphorylation
11875066 Role of insulin receptor dimerization domains in ligand binding, cooperativity, and modulation by anti-receptor antibodies
11866509 Chiral mutagenesis of insulin's hidden receptor-binding surface: structure of an allo-isoleucine(A2) analogue
11735220 Observational study of gene-disease association. (HuGE Navigator)
11232039 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MATGGRRGAAAAPLLVAVAALLLGAAGHLYPGEVCPGMDIRNNLTRLHELENCSVIEGHLQILLMFKTRP      1 - 70
EDFRDLSFPKLIMITDYLLLFRVYGLESLKDLFPNLTVIRGSRLFFNYALVIFEMVHLKELGLYNLMNIT     71 - 140
RGSVRIEKNNELCYLATIDWSRILDSVEDNYIVLNKDDNEECGDICPGTAKGKTNCPATVINGQFVERCW    141 - 210
THSHCQKVCPTICKSHGCTAEGLCCHSECLGNCSQPDDPTKCVACRNFYLDGRCVETCPPPYYHFQDWRC    211 - 280
VNFSFCQDLHHKCKNSRRQGCHQYVIHNNKCIPECPSGYTMNSSNLLCTPCLGPCPKVCHLLEGEKTIDS    281 - 350
VTSAQELRGCTVINGSLIINIRGGNNLAAELEANLGLIEEISGYLKIRRSYALVSLSFFRKLRLIRGETL    351 - 420
EIGNYSFYALDNQNLRQLWDWSKHNLTITQGKLFFHYNPKLCLSEIHKMEEVSGTKGRQERNDIALKTNG    421 - 490
DQASCENELLKFSYIRTSFDKILLRWEPYWPPDFRDLLGFMLFYKEAPYQNVTEFDGQDACGSNSWTVVD    491 - 560
IDPPLRSNDPKSQNHPGWLMRGLKPWTQYAIFVKTLVTFSDERRTYGAKSDIIYVQTDATNPSVPLDPIS    561 - 630
VSNSSSQIILKWKPPSDPNGNITHYLVFWERQAEDSELFELDYCLKGLKLPSRTWSPPFESEDSQKHNQS    631 - 700
EYEDSAGECCSCPKTDSQILKELEESSFRKTFEDYLHNVVFVPRKTSSGTGAEDPRPSRKRRSLGDVGNV    701 - 770
TVAVPTVAAFPNTSSTSVPTSPEEHRPFEKVVNKESLVISGLRHFTGYRIELQACNQDTPEERCSVAAYV    771 - 840
SARTMPEAKADDIVGPVTHEIFENNVVHLMWQEPKEPNGLIVLYEVSYRRYGDEELHLCVSRKHFALERG    841 - 910
CRLRGLSPGNYSVRIRATSLAGNGSWTEPTYFYVTDYLDVPSNIAKIIIGPLIFVFLFSVVIGSIYLFLR    911 - 980
KRQPDGPLGPLYASSNPEYLSASDVFPCSVYVPDEWEVSREKITLLRELGQGSFGMVYEGNARDIIKGEA    981 - 1050
ETRVAVKTVNESASLRERIEFLNEASVMKGFTCHHVVRLLGVVSKGQPTLVVMELMAHGDLKSYLRSLRP   1051 - 1120
EAENNPGRPPPTLQEMIQMAAEIADGMAYLNAKKFVHRDLAARNCMVAHDFTVKIGDFGMTRDIYETDYY   1121 - 1190
RKGGKGLLPVRWMAPESLKDGVFTTSSDMWSFGVVLWEITSLAEQPYQGLSNEQVLKFVMDGGYLDQPDN   1191 - 1260
CPERVTDLMRMCWQFNPKMRPTFLEIVNLLKDDLHPSFPEVSFFHSEENKAPESEELEMEFEDMENVPLD   1261 - 1330
RSSHCQREEAGGRDGGSSLGFKRSYEEHIPYTHMNGGKKNGRILTLPRSNPS                     1331 - 1382
//

Text Mined References (558)

PMID Year Title
27172637 Four Single Nucleotide Polymorphisms in INSR, SLC6A14, TAS2R38, and OR2W3 Genes in Association with Idiopathic Infertility in Persian Men.
26874853 2016 First molecular diagnosis of Donohue syndrome in Africa: novel unusual insertion/deletion mutation in the INSR gene.
26862994 2016 Development of a Quantitative PCR Assay for Detection of Human Insulin-Like Growth Factor Receptor and Insulin Receptor Isoforms.
26850678 2016 Preclinical and first-in-human phase I studies of KW-2450, an oral tyrosine kinase inhibitor with insulin-like growth factor receptor-1/insulin receptor selectivity.
26760116 2016 Low Oxygen Tension Modulates the Insulin-Like Growth Factor-1 or -2 Signaling via Both Insulin-Like Growth Factor-1 Receptor and Insulin Receptor to Maintain Stem Cell Identity in Placental Mesenchymal Stem Cells.
26721804 2016 Single-Nucleotide Polymorphism on Exon 17 of Insulin Receptor Gene Influences Insulin Resistance in PCOS: A Pilot Study on North Indian Women.
26584640 2016 mTORC2 promotes type I insulin-like growth factor receptor and insulin receptor activation through the tyrosine kinase activity of mTOR.
26438154 2015 BI 885578, a Novel IGF1R/INSR Tyrosine Kinase Inhibitor with Pharmacokinetic Properties That Dissociate Antitumor Efficacy and Perturbation of Glucose Homeostasis.
26406954 2015 Quantification of insulin receptor mRNA splice variants as a diagnostic tumor marker in breast cancer.
26297026 2015 Insulin and IGF1 signalling pathways in human astrocytes in vitro and in vivo; characterisation, subcellular localisation and modulation of the receptors.
26263910 2015 Intrinsic Resistance to Cixutumumab Is Conferred by Distinct Isoforms of the Insulin Receptor.
26251103 2016 Association of genetic variants in INS (rs689), INSR (rs1799816) and PP1G.G (rs1799999) with type 2 diabetes (T2D): a case-control study in three ethnic groups from North-West India.
26160152 2015 Identification and Functional Characterization of Two Novel Nonsense Mutations in the ?-Subunit of INSR That Cause Severe Insulin Resistance Syndrome.
26113601 2015 Non-small cell lung cancer cell survival crucially depends on functional insulin receptors.
26089371 2015 Insulin family polymorphisms in pregnancies complicated by small for gestational age infants.
26077721 2015 Insulin receptor variants and obesity-related cancers in the Framingham Heart Study.
26063811 2015 The R3 receptor-like protein tyrosine phosphatase subfamily inhibits insulin signalling by dephosphorylating the insulin receptor at specific sites.
25867326 2015 Associations between INSR and MTOR polymorphisms in type 2 diabetes mellitus and diabetic nephropathy in a Northeast Chinese Han population.
25758790 2015 The insulin and IGF1 receptor kinase domains are functional dimers in the activated state.
25753915 2015 Hyperinsulinemic hypoglycemia syndrome associated with mutations in the human insulin receptor gene: report of two cases.
25742416 2015 Aberrant liver insulin receptor isoform a expression normalises with remission of type 2 diabetes after gastric bypass surgery.
25687571 2015 The last enzyme of the de novo purine synthesis pathway 5-aminoimidazole-4-carboxamide ribonucleotide formyltransferase/IMP cyclohydrolase (ATIC) plays a central role in insulin signaling and the Golgi/endosomes protein network.
25622255 2015 The association between polymorphism of INSR and polycystic ovary syndrome: a meta-analysis.
25604425 2015 Specific insulin/IGF1 hybrid receptor activation assay reveals IGF1 as a more potent ligand than insulin.
25557790 2015 An exon variant in insulin receptor gene is associated with susceptibility to colorectal cancer in women.
25516545 2015 Pre-B cell colony enhancing factor induces Nampt-dependent translocation of the insulin receptor out of lipid microdomains in A549 lung epithelial cells.
25458098 2015 Association of insulin receptor H1085H C>T, insulin receptor substrate 1 G972R and insulin receptor substrate 2 1057G/A polymorphisms with refractory temporal lobe epilepsy in Han Chinese.
25416956 2014 A proteome-scale map of the human interactome network.
25351985 2015 Insulin requires normal expression and signaling of insulin receptor A to reverse gestational diabetes-reduced adenosine transport in human umbilical vein endothelium.
25102778 2015 Detection of phosphorylated insulin receptor in colorectal adenoma and adenocarcinoma: implications for prognosis and clinical outcome.
25017244 2014 Reduced insulin-like growth factor I receptor and altered insulin receptor isoform mRNAs in normal mucosa predict colorectal adenoma risk.
24973425 2014 Functional genetic approach identifies MET, HER3, IGF1R, INSR pathways as determinants of lapatinib unresponsiveness in HER2-positive gastric cancer.
24970814 2014 Engineered ubiquitin ligase PTB-U-box targets insulin/insulin-like growth factor receptor for degradation and coordinately inhibits cancer malignancy.
24939305 2014 Relationship between tyrosine phosphorylation and protein expression of insulin receptor and insulin resistance in gestational diabetes mellitus.
24867955 2014 Insulin receptor activation with transmembrane domain ligands.
24809298 2014 Oncogenic functions of IGF1R and INSR in prostate cancer include enhanced tumor growth, cell migration and angiogenesis.
24711643 2014 Identifying biological pathways that underlie primordial short stature using network analysis.
24683100 2014 Biological effects of insulin and its analogs on cancer cells with different insulin family receptor expression.
24679227 2014 Possible roles of insulin signaling in osteoblasts.
24583283 2014 A novel insulin receptor-signaling platform and its link to insulin resistance and type 2 diabetes.
24568043 Polycystic ovary syndrome: association of a C/T single nucleotide polymorphism at tyrosine kinase domain of insulin receptor gene with pathogenesis among lean Japanese women.
24535599 2014 Phosphorylation of Grb14 BPS domain by GSK-3 correlates with complex forming of Grb14 and insulin receptor.
24529663 2014 Insulin and insulin-like growth factor receptors in the brain: physiological and pathological aspects.
24508798 2014 Development of in vitro model of insulin receptor cleavage induced by high glucose in HepG2 cells.
24468607 2014 Identification of a novel insulin receptor gene heterozygous mutation in a patient with type A insulin resistance syndrome.
24277691 2014 Influence of breastfeeding on blood-cell transcript-based biomarkers of health in children.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24175768 2013 Is there an association between variants in candidate insulin pathway genes IGF-I, IGFBP-3, INSR, and IRS2 and risk of colorectal cancer in the Iranian population?
24127567 2013 Insulin receptor isoform switching in intestinal stem cells, progenitors, differentiated lineages and tumors: evidence that IR-B limits proliferation.
24097068 2013 Discovery and refinement of loci associated with lipid levels.
24078630 2013 LMBD1 protein serves as a specific adaptor for insulin receptor internalization.
23950881 2013 Overexpression of the insulin receptor isoform A promotes endometrial carcinoma cell growth.
23697264 2013 Genetic polymorphisms of INS, INSR and IRS-1 genes are not associated with polycystic ovary syndrome in Croatian women.
23666741 2013 Alternative splicing of human insulin receptor gene (INSR) in type I and type II skeletal muscle fibers of patients with myotonic dystrophy type 1 and type 2.
23633480 2013 Mitogenic insulin receptor-A is overexpressed in human hepatocellular carcinoma due to EGFR-mediated dysregulation of RNA splicing factors.
23457259 2013 The insulin receptor: both a prototypical and atypical receptor tyrosine kinase.
23408906 2013 A meta-analysis of thyroid-related traits reveals novel loci and gender-specific differences in the regulation of thyroid function.
23395167 2013 LRP6 enhances glucose metabolism by promoting TCF7L2-dependent insulin receptor expression and IGF receptor stabilization in humans.
23386514 2013 Indinavir and nelfinavir inhibit proximal insulin receptor signaling and salicylate abrogates inhibition: potential role of the NFkappa B pathway.
23382219 2013 Structural basis for endosomal trafficking of diverse transmembrane cargos by PX-FERM proteins.
23363253 2013 Insulin receptor, IRS1, IRS2, INSIG1, INSIG2, RRAD, and BAIAP2 gene expressions in glioma U87 cells with ERN1 loss of function: effect of hypoxia and glutamine or glucose deprivation.
23348915 2013 All-atom structural models of insulin binding to the insulin receptor in the presence of a tandem hormone-binding element.
23303383 2013 Single-nucleotide polymorphisms inside microRNA target sites influence the susceptibility to type 2 diabetes.
23302862 2013 How insulin engages its primary binding site on the insulin receptor.
23263486 2013 Genome-wide association analyses identify 18 new loci associated with serum urate concentrations.
23251408 2012 Insulin receptor isoforms A and B as well as insulin receptor substrates-1 and -2 are differentially expressed in prostate cancer.
23190452 2013 Regulation of insulin and type 1 insulin-like growth factor signaling and action by the Grb10/14 and SH2B1/B2 adaptor proteins.
23059533 2013 Altered expression and localization of insulin receptor in proximal tubule cells from human and rat diabetic kidney.
23018458 2012 Insulin modulates the inflammatory granulocyte response to streptococci via phosphatidylinositol 3-kinase.
22982059 2013 Circulating insulin-like growth factors may contribute substantially to insulin receptor isoform A and insulin receptor isoform B signalling.
22971162 2012 Insulin receptor and glucose transporters mRNA expression throughout the menstrual cycle in human endometrium: a physiological and cyclical condition of tissue insulin resistance.
22885925 2012 Genome-wide association study identifies eight new risk loci for polycystic ovary syndrome.
22879999 2012 Novel nuclear localization and potential function of insulin-like growth factor-1 receptor/insulin receptor hybrid in corneal epithelial cells.
22825921 2012 Insulin and IGF1 receptors in human cardiac microvascular endothelial cells: metabolic, mitogenic and anti-inflammatory effects.
22775283 2012 Association of His1085His INSR gene polymorphism with type 2 diabetes in South Indians.
22768670 2012 A novel mutation of the insulin receptor gene in a preterm infant with Donohue syndrome and heart failure.
22705438 2012 Association between insulin receptor gene polymorphism and the metabolic syndrome in Han and Yi Chinese.
22629383 2012 Soluble and cell-associated insulin receptor dysfunction correlates with severity of HAND in HIV-infected women.
22590634 2012 Extracellular nucleotides inhibit insulin receptor signaling, stimulate autophagy and control lipoprotein secretion.
22541124 2012 [Effects of insulin on expression of insulin receptor and insulin-like growth factor-1 receptor and proliferation in Reh cells].
22534794 2012 A two-stage matched case-control study on multiple hypertensive candidate genes in Han Chinese.
22493691 2012 Novel associations for hypothyroidism include known autoimmune risk loci.
22466604 2012 Insulin receptor isoforms are differently expressed during human osteoblastogenesis.
22438913 2012 Heterodimerization of glycosylated insulin-like growth factor-1 receptors and insulin receptors in cancer cells sensitive to anti-IGF1R antibody.
22404968 2013 PTP1B and TCPTP--nonredundant phosphatases in insulin signaling and glucose homeostasis.
22318726 2012 Insulin and insulin-like growth factor II differentially regulate endocytic sorting and stability of insulin receptor isoform A.
22278734 2012 The association between insulin and low-density lipoprotein receptors.
22278432 2012 Blood cells as a source of transcriptional biomarkers of childhood obesity and its related metabolic alterations: results of the IDEFICS study.
22189999 2012 Characterisation of adiponectin multimers and the IGF axis in humans with a heterozygote mutation in the tyrosine kinase domain of the insulin receptor gene.
22161861 2012 Epithelial-mesenchymal transition predicts sensitivity to the dual IGF-1R/IR inhibitor OSI-906 in hepatocellular carcinoma cell lines.
22140505 2011 Altered insulin receptor signalling and ?-cell cycle dynamics in type 2 diabetes mellitus.
22140443 2011 Understanding the mechanism of insulin and insulin-like growth factor (IGF) receptor activation by IGF-II.
22132154 2011 hnRNP A1 and hnRNP F modulate the alternative splicing of exon 11 of the insulin receptor gene.
22099628 2011 Identification of virtual signal transducers and activators of transcription response elements in the human insulin receptor gene promoter.
22082268 2011 Influence of placental mannose/n-acetyl glucosamine-binding proteins on the interaction of insulin and insulin-like growth factors with their receptors.
22081023 2011 A hepatocyte growth factor receptor (Met)-insulin receptor hybrid governs hepatic glucose metabolism.
22046260 2011 Altered expression of insulin receptor isoforms in breast cancer.
22017372 2012 Molecular characterization of a novel p.R118C mutation in the insulin receptor gene from patients with severe insulin resistance.
21913804 2011 Differential expression and signaling activation of insulin receptor isoforms A and B: A link between breast cancer and diabetes.
21908557 2011 A kinome-wide screen identifies the insulin/IGF-I receptor pathway as a mechanism of escape from hormone dependence in breast cancer.
21869538 2011 Functional characterization of insulin receptor gene mutations contributing to Rabson-Mendenhall syndrome - phenotypic heterogeneity of insulin receptor gene mutations.
21838706 2011 Insight into the molecular basis for the kinetic differences between the two insulin receptor isoforms.
21806020 2011 The metastasis-promoting phosphatase PRL-3 shows activity toward phosphoinositides.
21720388 2011 The association of phosphoinositide 3-kinase enhancer A with hepatic insulin receptor enhances its kinase activity.
21680660 2011 Research resource: New and diverse substrates for the insulin receptor isoform A revealed by quantitative proteomics after stimulation with IGF-II or insulin.
21645371 2011 Family association study between INSR gene polymorphisms and PCOS in Han Chinese.
21602145 2011 [Relation between insulin resistance and insulin receptor gene methylation in the endometrium of patients with polycystic ovary syndrome].
21535266 2011 Insulin-like growth factor 2 enhances insulinogenic differentiation of human eyelid adipose stem cells via the insulin receptor.
21524684 2011 Differential effects of IGF-I, IGF-II and insulin in human preadipocytes and adipocytes--role of insulin and IGF-I receptors.
21487008 2011 A new highly efficient substrate-trapping mutant of protein tyrosine phosphatase 1B (PTP1B) reveals full autoactivation of the insulin receptor precursor.
21441570 2011 Genome-wide meta-analysis for severe diabetic retinopathy.
21410323 2011 Insulin-like growth factor-2 (IGF-2) activates estrogen receptor-? and -? via the IGF-1 and the insulin receptors in breast cancer cells.
21346174 2011 Cannabinoids inhibit insulin receptor signaling in pancreatic ?-cells.
21318406 2011 Founder effect in the Horn of Africa for an insulin receptor mutation that may impair receptor recycling.
21300347 2011 Replication of association of a novel insulin receptor gene polymorphism with polycystic ovary syndrome.
21204696 2011 Insulin receptor H1085H C>T and insulin receptor substrate 1 G972R polymorphisms and prostate cancer risk: a pilot study.
21177763 2011 High IGF-IR activity in triple-negative breast cancer cell lines and tumorgrafts correlates with sensitivity to anti-IGF-IR therapy.
21139137 2010 Dependence receptors: the trophic theory revisited.
21123448 2011 Insulin receptor isoforms and insulin-like growth factor receptor in human follicular cell precursors from papillary thyroid cancer and normal thyroid.
21113646 2011 Single nucleotide polymorphisms within functional regions of genes implicated in insulin action and association with the insulin resistant phenotype.
21082232 2011 Influence of gene variants related to calcium homeostasis on biochemical parameters of women with polycystic ovary syndrome.
20971123 2011 Polymorphisms affecting micro-RNA regulation and associated with the risk of dietary-related cancers: a review from the literature and new evidence for a functional role of rs17281995 (CD86) and rs1051690 (INSR), previously associated with colorectal cancer.
20881960 2010 Hundreds of variants clustered in genomic loci and biological pathways affect human height.
20857837 2010 The involvement of insulin receptor genotypes in pre- and co-obese acanthosis Nigricans children and adolescent.
20855565 2010 Common genetic variation in multiple metabolic pathways influences susceptibility to low HDL-cholesterol and coronary heart disease.
20849815 2010 Crosstalk between insulin receptor and G protein-coupled receptor signaling systems leads to Ca²+ oscillations in pancreatic cancer PANC-1 cells.
20734064 2010 A large-scale candidate gene association study of age at menarche and age at natural menopause.
20674666 2010 Protein kinase D activation stimulates the transcription of the insulin receptor gene.
20634197 2010 Comprehensive analysis of common genetic variation in 61 genes related to steroid hormone and insulin-like growth factor-I metabolism and breast cancer risk in the NCI breast and prostate cancer cohort consortium.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20624623 2010 Increased insulin receptor expression in anterior temporal neocortex of patients with intractable epilepsy.
20620597 2010 The expression and role of hybrid insulin/insulin-like growth factor receptor type 1 in endometrial carcinoma cells.
20602615 2010 Physiogenomic analysis of statin-treated patients: domain-specific counter effects within the ACACB gene on low-density lipoprotein cholesterol?
20568733 2010 Kinetic evidence for the sequential association of insulin binding sites 1 and 2 to the insulin receptor and the influence of receptor isoform.
20521171 2010 Loss of NPC1 function in a patient with a co-inherited novel insulin receptor mutation does not grossly modify the severity of the associated insulin resistance.
20493471 2010 Association of insulin receptor genetic variants with polycystic ovary syndrome in a population of women from Central Europe.
20468064 2010 Association study of 182 candidate genes in anorexia nervosa.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20455999 2011 A novel domain of caveolin-2 that controls nuclear targeting: regulation of insulin-specific ERK activation and nuclear translocation by caveolin-2.
20421297 2010 Mass and information feedbacks through receptor endocytosis govern insulin signaling as revealed using a parameter-free modeling framework.
20416077 2010 Identification of type 2 diabetes-associated combination of SNPs using support vector machine.
20360006 2010 Insulin and insulin-like growth factor-1 receptors act as ligand-specific amplitude modulators of a common pathway regulating gene transcription.
20348418 2010 Structural resolution of a tandem hormone-binding element in the insulin receptor and its implications for design of peptide agonists.
20339196 2010 Phenotypical variety of insulin resistance in a family with a novel mutation of the insulin receptor gene.
20200332 2010 Family-based analysis of candidate genes for polycystic ovary syndrome.
20068229 2010 Cyclic nucleotides converge on brown adipose tissue differentiation.
20009360 2010 Tumor necrosis factor-alpha (TNF-alpha) inhibits insulin-like growth factor-I (IGF-I) activities in human trophoblast cell cultures through IGF-I/insulin hybrid receptors.
19996272 2009 BMS-754807, a small molecule inhibitor of insulin-like growth factor-1R/IR.
19950604 2009 [Autophosphorylation of erythrocyte insulin receptors in patients with polycystic ovary syndrome].
19948975 2009 Integrative predictive model of coronary artery calcification in atherosclerosis.
19926323 2010 Polymorphisms of the insulin receptor and the insulin receptor substrates genes in polycystic ovary syndrome: a Mendelian randomization meta-analysis.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19898946 2010 Synchronization in G0/G1 enhances the mitogenic response of cells overexpressing the human insulin receptor A isoform to insulin.
19835884 2009 Solution structure of ectodomains of the insulin receptor family: the ectodomain of the type 1 insulin-like growth factor receptor displays asymmetry of ligand binding accompanied by limited conformational change.
19817984 2009 Insulin/IGF-1 hybrid receptor expression on human platelets: consequences for the effect of insulin on platelet function.
19815552 2009 Low density lipoprotein receptor-related protein 1 promotes anti-apoptotic signaling in neurons by activating Akt survival pathway.
19720790 2009 Severe insulin resistance and intrauterine growth deficiency associated with haploinsufficiency for INSR and CHN2: new insights into synergistic pathways involved in growth and metabolism.
19692168 2010 Genetic susceptibility to distinct bladder cancer subphenotypes.
19688022 2009 Insulin receptor gene mutations in iranian patients with type II diabetes mellitus.
19654240 2009 The human insulin receptor mRNA contains a functional internal ribosome entry segment.
19625176 2009 PTEN identified as important risk factor of chronic obstructive pulmonary disease.
19578796 2009 Association of genetic variants with chronic kidney disease in individuals with different lipid profiles.
19575708 2009 Insulin receptor signaling regulates actin cytoskeletal organization in developing photoreceptors.
19560451 2009 A novel ultra-sensitive enzyme immunoassay for soluble human insulin receptor ectodomain and its measurement in urine from healthy subjects and patients with diabetes mellitus.
19541767 2009 Autophagy-mediated insulin receptor down-regulation contributes to endoplasmic reticulum stress-induced insulin resistance.
19459609 2009 A thermodynamic study of ligand binding to the first three domains of the human insulin receptor: relationship between the receptor alpha-chain C-terminal peptide and the site 1 insulin mimetic peptides.
19406747 2009 Insulin receptor dysfunction impairs cellular clearance of neurotoxic oligomeric a{beta}.
19394223 2009 Discovery of 3,5-disubstituted-1H-pyrrolo[2,3-b]pyridines as potent inhibitors of the insulin-like growth factor-1 receptor (IGF-1R) tyrosine kinase.
19387820 2009 Genetic polymorphisms of FSHR, CYP17, CYP1A1, CAPN10, INSR, SERPINE1 genes in adolescent girls with polycystic ovary syndrome.
19369195 2009 Large-scale proteomics analysis of the human kinome.
19349973 2009 Mass-spectrometric identification and relative quantification of N-linked cell surface glycoproteins.
19326042 2009 Comparative transcriptional and biochemical studies in muscle of myotonic dystrophies (DM1 and DM2).
19246519 2009 Insulin and leptin receptors as possible new candidates for endocrine control in normal and disturbed human pregnancy.
19219452 2009 Caveolin, GLUT4 and insulin receptor protein content in human arm and leg muscles.
19211708 2009 Genetic variation in exon 17 of INSR is associated with insulin resistance and hyperandrogenemia among lean Indian women with polycystic ovary syndrome.
19170714 2009 Hyperinsulinaemic hypoglycaemia associated with a heterozygous missense mutation of R1174W in the insulin receptor (IR) gene.
19170196 2009 Polymorphisms in innate immunity genes and lung cancer risk in Xuanwei, China.
19167335 2009 Large-scale structural analysis of the classical human protein tyrosine phosphatome.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
19139090 2009 A novel approach to identify two distinct receptor binding surfaces of insulin-like growth factor II.
19135752 2009 Two related cases of type A insulin resistance with compound heterozygous mutations of the insulin receptor gene.
19071018 2009 Optimization of 4,6-bis-anilino-1H-pyrrolo[2,3-d]pyrimidine IGF-1R tyrosine kinase inhibitors towards JNK selectivity.
19064572 2008 Polymorphism in the IL18 gene and epithelial ovarian cancer in non-Hispanic white women.
19056263 2009 Discovery of 4,6-bis-anilino-1H-pyrrolo[2,3-d]pyrimidines: potent inhibitors of the IGF-1R receptor tyrosine kinase.
19051206 Autoreactive T-cell receptor (Vbeta/D/Jbeta) sequences in diabetes are homologous to insulin, glucagon, the insulin receptor, and the glucagon receptor.
19047369 2009 SRp20 and CUG-BP1 modulate insulin receptor exon 11 alternative splicing.
19029027 2009 Diabetes reduces autophosphorylation of retinal insulin receptor and increases protein-tyrosine phosphatase-1B activity.
18996102 2009 Physiogenomic comparison of edema and BMI in patients receiving rosiglitazone or pioglitazone.
18991400 2008 High-affinity insulin binding: insulin interacts with two receptor ligand binding sites.
18925540 2008 Protein tyrosine phosphatase regulation in fibroblasts from patients with an insulin receptor gene mutation.
18834871 2009 Sex steroids enhance insulin receptors and glucose oxidation in Chang liver cells.
18828733 2008 Anthropometry, carbohydrate and lipid metabolism in the East Flanders Prospective Twin Survey: linkage of candidate genes using two sib-pair based variance components analyses.
18785179 2009 Insulin receptor expression by human prostate cancers.
18767165 2008 Identification of a key element for hydrogen-bonding patterns between protein kinases and their inhibitors.
18716398 2009 Analysis of the association of preeclampsia with polymorphisms of the INS, INSR and IRS1 genes in Mexican women.
18711691 2008 Differential expression of IGF-I and insulin receptor isoforms in HPV positive and negative human cervical cancer cell lines.
18708119 2008 Human microvascular endothelial cells are sensitive to IGF-I but resistant to insulin at the receptor level.
18693051 2009 Changes in insulin and IGF-I receptor expression during differentiation of human preadipocytes.
18676680 2008 Pathway-based evaluation of 380 candidate genes and lung cancer susceptibility suggests the importance of the cell cycle pathway.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18660489 2008 Multiple genetic variants along candidate pathways influence plasma high-density lipoprotein cholesterol concentrations.
18616667 2008 Insulin and insulin-like growth factor resistance in alcoholic neurodegeneration.
18556968 2008 Insulin receptor autoimmunity and insulin resistance.
18535540 2008 Prolactin and insulin ultradian secretion and adipose tissue lipoprotein lipase expression in severely obese women after bariatric surgery.
18455362 2008 Replication study of the insulin receptor gene in migraine with aura.
18348886 2008 Corosolic acid stimulates glucose uptake via enhancing insulin receptor phosphorylation.
18318661 2008 Activation of the insulin receptor (IR) by insulin and a synthetic peptide has different effects on gene expression in IR-transfected L6 myoblasts.
18278056 2008 Structural and biochemical characterization of the KRLB region in insulin receptor substrate-2.
18249389 2008 Polymorphism in postinsulin receptor signaling pathway is not associated with polycystic ovary syndrome.
18048361 2008 Structural basis for the lower affinity of the insulin-like growth factors for the insulin receptor.
17965293 2007 Elevated plasma adiponectin and leptin levels in sisters with genetically defective insulin receptors.
17957771 2008 N-linked glycans of the human insulin receptor and their distribution over the crystal structure.
17925406 2007 Activation of the insulin receptor by insulin and a synthetic peptide leads to divergent metabolic and mitogenic signaling and responses.
17914103 2007 Insulin pathway related genes and risk of colorectal cancer: INSR promoter polymorphism shows a protective effect.
17855343 2007 Soluble Abeta inhibits specific signal transduction cascades common to the insulin receptor pathway.
17854350 2007 Post-synaptic density perturbs insulin-induced Kv1.3 channel modulation via a clustering mechanism involving the SH3 domain.
17658524 2008 A novel single nucleotide polymorphism of INSR gene for polycystic ovary syndrome.
17577576 2007 Generation of intracellular domain of insulin receptor tyrosine kinase by gamma-secretase.
17563366 2007 Calreticulin and Hsp90 stabilize the human insulin receptor and promote its mobility in the endoplasmic reticulum.
17563065 2007 Soluble insulin receptor ectodomain is elevated in the plasma of patients with diabetes.
17556377 2007 IGF-II regulates metastatic properties of choriocarcinoma cells through the activation of the insulin receptor.
17481567 2007 An enzyme-linked immunosorbent assay to measure insulin receptor dephosphorylation by PTP1B.
17475934 2007 Adiponectin resistance exacerbates insulin resistance in insulin receptor transgenic/knockout mice.
17434141 2007 Fatty acid represses insulin receptor gene expression by impairing HMGA1 through protein kinase Cepsilon.
17416760 2007 Insulin resistance-related genes and advanced left-sided colorectal adenoma.
17374711 2007 Interactions among peroxisome proliferator activated receptor-gamma, insulin signaling pathways, and steroidogenic acute regulatory protein in human ovarian cells.
17348446 Nested case-control study of energy regulation candidate gene single nucleotide polymorphisms and breast cancer.
17347799 2007 Regulation of insulin receptor function.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
17344070 2007 Human insulin receptor juxtamembrane domain independent insulin signaling.
17340225 2007 Insulin-like effects of visfatin on human osteoblasts.
17325037 2007 Differential activation of insulin receptor substrates 1 and 2 by insulin-like growth factor-activated insulin receptors.
17275003 2007 Genetic risk for restenosis after coronary stenting.
17229154 2007 Alpha 1,3-fucosyltransferase-VII regulates the signaling molecules of the insulin receptor pathway.
17221153 2007 Insulin receptor is an independent predictor of a favorable outcome in early stage breast cancer.
17201797 2007 Functional characterization of a novel insulin receptor mutation contributing to Rabson-Mendenhall syndrome.
17159996 2007 Regulation of protein tyrosine phosphatase 1B by sumoylation.
17135270 2007 The role of the C-terminal domain of protein tyrosine phosphatase-1B in phosphatase activity and substrate binding.
17102568 2007 APS-mediated ubiquitination of the insulin receptor enhances its internalization, but does not induce its degradation.
17092689 2007 Direct interaction between ER membrane-bound PTP1B and its plasma membrane-anchored targets.
17078079 2007 The location and characterisation of the O-linked glycans of the human insulin receptor.
17001305 2007 The insulin receptor is essential for virus-induced tumorigenesis of Kaposi's sarcoma.
16962112 2006 Effects of hyperglycemia on the differential expression of insulin and insulin-like growth factor-I receptors in human normal peritoneal and adhesion fibroblasts.
16957736 2006 Structure of the insulin receptor ectodomain reveals a folded-over conformation.
16946708 2006 Interaction of muscleblind, CUG-BP1 and hnRNP H proteins in DM1-associated aberrant IR splicing.
16926280 2006 Monitoring the activation state of insulin/insulin-like growth factor-1 hybrid receptors using bioluminescence resonance energy transfer.
16894147 2006 The first three domains of the insulin receptor differ structurally from the insulin-like growth factor 1 receptor in the regions governing ligand specificity.
16831875 2006 Hybrid receptors formed by insulin receptor (IR) and insulin-like growth factor I receptor (IGF-IR) have low insulin and high IGF-1 affinity irrespective of the IR splice variant.
16814253 2006 Characterization of a second ligand binding site of the insulin receptor.
16806206 2006 Single nucleotide polymorphism in exon 17 of the insulin receptor gene is not associated with polycystic ovary syndrome in a Korean population.
16761106 2006 Partial rescue of in vivo insulin signalling in skeletal muscle by impaired insulin clearance in heterozygous carriers of a mutation in the insulin receptor gene.
16582879 2006 Interaction with Grb14 results in site-specific regulation of tyrosine phosphorylation of the insulin receptor.
16510536 2006 A novel SNP at exon 17 of INSR is associated with decreased insulin sensitivity in Chinese women with PCOS.
16493415 2006 Critical nodes in signalling pathways: insights into insulin action.
16473310 No mutations detected in the INSR gene in a chromosome 19p13 linked migraine pedigree.
16382134 2006 RACK1 recruits STAT3 specifically to insulin and insulin-like growth factor 1 receptors for activation, which is important for regulating anchorage-independent growth.
16314505 2005 Tyrosine phosphorylation of phosphoinositide-dependent kinase 1 by the insulin receptor is necessary for insulin metabolic signaling.
16271887 2005 Crystal structure of a complex between protein tyrosine phosphatase 1B and the insulin receptor tyrosine kinase.
16246733 2005 Structural basis for inhibition of the insulin receptor by the adaptor protein Grb14.
16137651 2005 Natural anti-diabetic compound 1,2,3,4,6-penta-O-galloyl-D-glucopyranose binds to insulin receptor and activates insulin-mediated glucose transport signaling pathway.
16127460 2005 Deletion of SOCS7 leads to enhanced insulin action and enlarged islets of Langerhans.
16084832 2005 Hyperglycemia-induced activation of human T-lymphocytes with de novo emergence of insulin receptors and generation of reactive oxygen species.
15951569 2005 Time-resolved mass spectrometry of tyrosine phosphorylation sites in the epidermal growth factor receptor signaling network reveals dynamic modules.
15938783 2005 [Polymorphism in insulin receptor gene exon 17 in women with polycystic ovary syndrome].
15862945 2005 Identification of two functional estrogen response elements complexed with AP-1-like sites in the human insulin receptor gene promoter.
15799978 2005 Characterization of the functional insulin binding epitopes of the full-length insulin receptor.
15745246 2004 Polymorphisms of exon 17 of insulin-receptor gene in pathogenesis of human disorders with insulin resistance.
15738637 2005 Receptor-type protein tyrosine phosphatase epsilon (PTPepsilonM) is a negative regulator of insulin signaling in primary hepatocytes and liver.
15715521 2005 Cross down-regulation of leptin and insulin receptor expression and signalling in a human neuronal cell line.
15708546 2005 Placental insulin and insulin-like growth factor I receptors in normal and preeclamptic pregnancies.
15694368 2005 AICAR, an activator of AMP-activated protein kinase, down-regulates the insulin receptor expression in HepG2 cells.
15632081 2005 Coordinated regulation of insulin signaling by the protein tyrosine phosphatases PTP1B and TCPTP.
15629149 2005 Comparative analysis of the signaling capabilities of the insulin receptor-related receptor.
15590636 2005 Human insulin receptor substrate-1 (IRS-1) polymorphism G972R causes IRS-1 to associate with the insulin receptor and inhibit receptor autophosphorylation.
15588987 2005 Applying the SPOT peptide synthesis procedure to the study of protein tyrosine phosphatase substrate specificity: probing for the heavenly match in vitro.
15588985 2005 Substrate-trapping techniques in the identification of cellular PTP targets.
15582274 Association analysis between longevity in the Japanese population and polymorphic variants of genes involved in insulin and insulin-like growth factor 1 signaling pathways.
15581831 DNA polymorphism analysis of candidate genes for type 2 diabetes mellitus in a Mexican ethnic group.
15563471 2005 Interdependent regulation of insulin receptor kinase activity by ADP and hydrogen peroxide.
15522217 2004 Mutational analysis of the interaction between insulin receptor and IGF-I receptor with c-Crk and Crk-L in a yeast two-hybrid system.
15498182 2004 [Correlation between single nucleotide polymorphism of insulin receptor gene with polycystic ovary syndrome].
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15485753 2004 Insulin receptor number is reduced in healthy offspring of patients with essential hypertension.
15337529 2004 Src tyrosine kinase regulates insulin-induced activation of protein kinase C (PKC) delta in skeletal muscle.
15240646 2004 Insulin and messenger ribonucleic acid expression of insulin receptor isoforms in ovarian follicles from nonhirsute ovulatory women and polycystic ovary syndrome patients.
15233842 2004 Assembly of splicing complexes on exon 11 of the human insulin receptor gene does not correlate with splicing efficiency in-vitro.
15205474 2004 Structural determinants for high-affinity binding of insulin-like growth factor II to insulin receptor (IR)-A, the exon 11 minus isoform of the IR.
15192089 2004 Regulation of insulin signaling through reversible oxidation of the protein-tyrosine phosphatases TC45 and PTP1B.
15182363 2004 Colocalization of insulin receptor and insulin receptor substrate-1 to caveolae in primary human adipocytes. Cholesterol depletion blocks insulin signalling for metabolic and mitogenic control.
15169905 2004 Suppressor of cytokine signaling 1 (SOCS-1) and SOCS-3 cause insulin resistance through inhibition of tyrosine phosphorylation of insulin receptor substrate proteins by discrete mechanisms.
15161766 2004 A novel syndrome of autosomal-dominant hyperinsulinemic hypoglycemia linked to a mutation in the human insulin receptor gene.
15114529 2004 Insulin receptor splicing alteration in myotonic dystrophy type 2.
15069075 2004 Protein kinase C-zeta-induced phosphorylation of Ser318 in insulin receptor substrate-1 (IRS-1) attenuates the interaction with the insulin receptor and the tyrosine phosphorylation of IRS-1.
15061947 2004 [Study on the relationship between polymorphism of insulin-receptor gene EXON2-2257 and insulin resistance in Chinese people].
15057824 2004 The DNA sequence and biology of human chromosome 19.
14729945 2004 Regulation of phosphoinositide 3-kinase by its intrinsic serine kinase activity in vivo.
14722096 2004 Protein tyrosine phosphatase-1B dephosphorylation of the insulin receptor occurs in a perinuclear endosome compartment in human embryonic kidney 293 cells.
14722023 2004 Insulin-like growth factor I receptors are more abundant than insulin receptors in human micro- and macrovascular endothelial cells.
14693412 2004 Polymorphisms in candidate genes for type 2 diabetes mellitus in a Mexican population with metabolic syndrome findings.
14690593 2003 Structural basis for recruitment of the adaptor protein APS to the activated insulin receptor.
14568990 2003 Role of the pleckstrin homology domain of PLCgamma1 in its interaction with the insulin receptor.
14551916 2003 Candidate gene association study in type 2 diabetes indicates a role for genes involved in beta-cell function as well as insulin action.
12970295 2003 Identification and functional assessment of novel and known insulin receptor mutations in five patients with syndromes of severe insulin resistance.
12881524 2003 Differential gene expression induced by insulin and insulin-like growth factor-II through the insulin receptor isoform A.
12878213 2003 Gene expression in human cells with mutant insulin receptors.
12850828 2003 Circulating heavy chain IgG, a pathological mediator for coronary artery disease, recognizes platelet surface receptors of both prostacyclin and insulin.
12738810 2003 Chronic hyperglycemia impairs insulin secretion by affecting insulin receptor expression, splicing, and signaling in RIN beta cell line and human islets of Langerhans.
12734206 2003 Interaction of filamin A with the insulin receptor alters insulin-dependent activation of the mitogen-activated protein kinase pathway.
12732844 2003 A study to survey susceptible genetic factors responsible for troglitazone-associated hepatotoxicity in Japanese patients with type 2 diabetes mellitus.
12730241 2003 Two new substrates in insulin signaling, IRS5/DOK4 and IRS6/DOK5.
12711007 2003 Identification of a Vitamin D response element in the human insulin receptor gene promoter.
12707268 2003 Structural and biochemical evidence for an autoinhibitory role for tyrosine 984 in the juxtamembrane region of the insulin receptor.
12665574 2003 A nucleoprotein complex containing Sp1, C/EBP beta, and HMGI-Y controls human insulin receptor gene transcription.
12660731 2003 The role of PI3K in immune cells.
12654724 2003 A divergent INS protein in Caenorhabditis elegans structurally resembles human insulin and activates the human insulin receptor.
12634852 2003 Dynamics of the interaction between the insulin receptor and protein tyrosine-phosphatase 1B in living cells.
12613967 2002 Insulin, insulin receptor and insulin-like growth factor-I receptor on the human ocular surface.
12612081 2003 Regulation of insulin receptor signaling by the protein tyrosine phosphatase TCPTP.
12575209 2002 [Relation between insulin resistance and A1166C molecular variant of type 1 angiotensin II receptor gene in patients with coronary heart disease].
12560330 2003 Suppressor of cytokine signaling-3 (SOCS-3), a potential mediator of interleukin-6-dependent insulin resistance in hepatocytes.
12538626 2003 Deletion of V335 from the L2 domain of the insulin receptor results in a conformationally abnormal receptor that is unable to bind insulin and causes Donohue's syndrome in a human subject.
12493740 2003 Grb10 inhibits insulin-stimulated insulin receptor substrate (IRS)-phosphatidylinositol 3-kinase/Akt signaling pathway by disrupting the association of IRS-1/IRS-2 with the insulin receptor.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12477518 2002 A C/T single nucleotide polymorphism at the tyrosine kinase domain of the insulin receptor gene is associated with polycystic ovary syndrome.
12468540 2003 The role of C-terminal tyrosine phosphorylation in the regulation of SHP-1 explored via expressed protein ligation.
12456798 2002 Dual mechanism of signal transducer and activator of transcription 5 activation by the insulin receptor.
12420346 2002 [Insulin receptor gene polymorphism in myocardial infarction patients].
12270939 2002 Comparison of the functional insulin binding epitopes of the A and B isoforms of the insulin receptor.
12237775 2002 Biological activity of the thyroid TRK-T3 oncogene requires signalling through Shc.
12237455 2002 The SPOT technique as a tool for studying protein tyrosine phosphatase substrate specificities.
12193537 2002 Functional insulin receptors on human epithelial ovarian carcinoma cells: implications for IGF-II mitogenic signaling.
12153558 2002 Phosphorylation of calmodulin. Functional implications.
12138094 2002 Insulin/insulin-like growth factor I hybrid receptors have different biological characteristics depending on the insulin receptor isoform involved.
12125099 2002 Transcriptional activation of the human insulin receptor gene by 1,25-dihydroxyvitamin D(3).
12112020 2002 Sam68 associates with the SH3 domains of Grb2 recruiting GAP to the Grb2-SOS complex in insulin receptor signaling.
12107746 2002 An arginine to cysteine(252) mutation in insulin receptors from a patient with severe insulin resistance inhibits receptor internalisation but preserves signalling events.
12023989 2002 Genotype-phenotype correlation in inherited severe insulin resistance.
11997497 2002 APS facilitates c-Cbl tyrosine phosphorylation and GLUT4 translocation in response to insulin in 3T3-L1 adipocytes.
11994298 2002 Identification of pp68 as the Tyrosine-phosphorylated Form of SYNCRIP/NSAP1. A cytoplasmic RNA-binding protein.
11866509 2002 Chiral mutagenesis of insulin's hidden receptor-binding surface: structure of an allo-isoleucine(A2) analogue.
11796522 2002 PLC-gamma1 enzyme activity is required for insulin-induced DNA synthesis.
11735220 2001 Single-nucleotide polymorphism alleles in the insulin receptor gene are associated with typical migraine.
11726652 2002 Inhibition of insulin receptor catalytic activity by the molecular adapter Grb14.
11694516 2002 Shc and CEACAM1 interact to regulate the mitogenic action of insulin.
11606564 2002 Phosphorylation of Ser307 in insulin receptor substrate-1 blocks interactions with the insulin receptor and inhibits insulin action.
11598120 2001 Multiple activation loop conformations and their regulatory properties in the insulin receptor's kinase domain.
11579209 2001 Phosphorylation of PTP1B at Ser(50) by Akt impairs its ability to dephosphorylate the insulin receptor.
11551902 2001 Insulin receptor-mediated p62dok tyrosine phosphorylation at residues 362 and 398 plays distinct roles for binding GTPase-activating protein and Nck and is essential for inhibiting insulin-stimulated activation of Ras and Akt.
11506178 2001 Phosphorylation and activation of protein tyrosine phosphatase (PTP) 1B by insulin receptor.
11500939 2001 Regulation of the Akt/Glycogen synthase kinase-3 axis by insulin-like growth factor-II via activation of the human insulin receptor isoform-A.
11409918 2000 Complexes formation between insulin receptor and extracellular signal-regulated kinases ERKs.
11401470 2001 Identification of Ser(1275) and Ser(1309) as autophosphorylation sites of the human insulin receptor in intact cells.
11374898 2001 Cloning, mapping, and characterization of the human sorbin and SH3 domain containing 1 (SORBS1) gene: a protein associated with c-Abl during insulin signaling in the hepatoma cell line Hep3B.
11342531 2001 Suppressors of cytokine signaling-1 and -6 associate with and inhibit the insulin receptor. A potential mechanism for cytokine-mediated insulin resistance.
11289049 2001 The Q allele variant (GLN121) of membrane glycoprotein PC-1 interacts with the insulin receptor and inhibits insulin signaling more effectively than the common K allele variant (LYS121).
11279102 2001 Sorting nexin 6, a novel SNX, interacts with the transforming growth factor-beta family of receptor serine-threonine kinases.
11266508 2001 Insulin induces specific interaction between insulin receptor and protein kinase C delta in primary cultured skeletal muscle.
11260230 2001 Identification of novel C253Y missense and Y864X nonsense mutations in the insulin receptor gene in type A insulin-resistant patients.
11232039 2001 Evidence for association of polycystic ovary syndrome in caucasian women with a marker at the insulin receptor gene locus.
11208515 Insulin receptor--structural and functional characteristics.
11163213 2000 Molecular basis for the dephosphorylation of the activation segment of the insulin receptor by protein tyrosine phosphatase 1B.
11158333 2001 Distinct functions of the two protein tyrosine phosphatase domains of LAR (leukocyte common antigen-related) on tyrosine dephosphorylation of insulin receptor.
11136729 2001 Protein-tyrosine phosphatase-1B negatively regulates insulin signaling in l6 myocytes and Fao hepatoma cells.
11124964 2001 Crystallographic and solution studies of an activation loop mutant of the insulin receptor tyrosine kinase: insights into kinase mechanism.
11094073 2000 Vav3 mediates receptor protein tyrosine kinase signaling, regulates GTPase activity, modulates cell morphology, and induces cell transformation.
11075717 2000 The functional significance of Shc in insulin signaling as a substrate of the insulin receptor.
11071852 2000 Suppressor of cytokine signaling (SOCS)-3 protein interacts with the insulin-like growth factor-I receptor.
11001060 2000 CAP defines a second signalling pathway required for insulin-stimulated glucose transport.
10978177 2000 Identification of major tyrosine phosphorylation sites in the human insulin receptor substrate Gab-1 by insulin receptor kinase in vitro.
10921922 2000 Intracellular signaling mechanisms leading to synergistic effects of endothelin-1 and stem cell factor on proliferation of cultured human melanocytes. Cross-talk via trans-activation of the tyrosine kinase c-kit receptor.
10896916 2000 Alpha(2) adrenoceptors regulate proliferation of human intestinal epithelial cells.
10830280 2000 Stat 5B, activated by insulin in a Jak-independent fashion, plays a role in glucokinase gene transcription.
10816433 2000 The m3 muscarinic acetylcholine receptor is coupled to mitogen-activated protein kinase via protein kinase C and epidermal growth factor receptor kinase.
10805733 2000 The differential effects of pp120 (Ceacam 1) on the mitogenic action of insulin and insulin-like growth factor 1 are regulated by the nonconserved tyrosine 1316 in the insulin receptor.
10803466 2000 Evidence for an interaction between the insulin receptor and Grb7. A role for two of its binding domains, PIR and SH2.
10764799 2000 Selective attenuation of metabolic branch of insulin receptor down-signaling by high glucose in a hepatoma cell line, HepG2 cells.
10747347 2000 Roles for insulin receptor, PI3-kinase, and Akt in insulin-signaling pathways related to production of nitric oxide in human vascular endothelial cells.
10734133 2000 Identification of tyrosine phosphatases that dephosphorylate the insulin receptor. A brute force approach based on "substrate-trapping" mutants.
10733238 2000 Identification of three novel mutations in the insulin receptor gene in type A insulin resistant patients.
10660596 2000 Tyrosine dephosphorylation and deactivation of insulin receptor substrate-1 by protein-tyrosine phosphatase 1B. Possible facilitation by the formation of a ternary complex with the Grb2 adaptor protein.
10650943 2000 Potential involvement of FRS2 in insulin signaling.
10635327 1999 Ubiquitin ligase activity and tyrosine phosphorylation underlie suppression of growth factor signaling by c-Cbl/Sli-1.
10615944 2000 Membrane glycoprotein PC-1 inhibition of insulin receptor function occurs via direct interaction with the receptor alpha-subunit.
10598578 1999 Caveolin-1 interacts with the insulin receptor and can differentially modulate insulin signaling in transfected Cos-7 cells and rat adipose cells.
10594240 1999 Alternative splicing, gene localization, and binding of SH2-B to the insulin receptor kinase domain.
10500481 1999 A fluorescent indicator for tyrosine phosphorylation-based insulin signaling pathways.
10482988 1999 SHC and SHIP phosphorylation and interaction in response to activation of the FLT3 receptor.
10453981 1999 Differential regulation of signaling pathways for insulin and insulin-like growth factor I.
10443650 1999 Progressive decline in insulin levels in Rabson-Mendenhall syndrome.
10437794 1999 p68 Sam is a substrate of the insulin receptor and associates with the SH2 domains of p85 PI3K.
10207053 1999 Insulin receptor isoform A, a newly recognized, high-affinity insulin-like growth factor II receptor in fetal and cancer cells.
10196204 1999 Identification of the APS protein as a novel insulin receptor substrate.
10084586 1999 Prevalence of variants in candidate genes for type 2 diabetes mellitus in The Netherlands: the Rotterdam study and the Hoorn study.
10026153 1999 C-terminal Src kinase associates with ligand-stimulated insulin-like growth factor-I receptor.
9819414 1998 Identification of a family of sorting nexin molecules and characterization of their association with receptors.
9819385 1998 Requirement of atypical protein kinase clambda for insulin stimulation of glucose uptake but not for Akt activation in 3T3-L1 adipocytes.
9756945 1998 Caveolin is an activator of insulin receptor signaling.
9748281 1998 Identification of the rat adapter Grb14 as an inhibitor of insulin actions.
9742218 1998 SH2-Balpha is an insulin-receptor adapter protein and substrate that interacts with the activation loop of the insulin-receptor kinase.
9741627 1998 A requirement for caveolin-1 and associated kinase Fyn in integrin signaling and anchorage-dependent cell growth.
9722981 1998 Insulin-like growth factor II (IGF-II).
9710204 1998 Roles of Lck, Syk and ZAP-70 tyrosine kinases in TCR-mediated phosphorylation of the adapter protein Shc.
9703342 1998 Multiple molecular mechanisms of insulin receptor dysfunction in a patient with Donohue syndrome.
9658397 1998 Determination of Gab1 (Grb2-associated binder-1) interaction with insulin receptor-signaling molecules.
9593725 1998 Association of the insulin receptor with phospholipase C-gamma (PLCgamma) in 3T3-L1 adipocytes suggests a role for PLCgamma in metabolic signaling by insulin.
9524259 1998 Cloning of human p55 gamma, a regulatory subunit of phosphatidylinositol 3-kinase, by a yeast two-hybrid library screen with the insulin-like growth factor-I receptor.
9507031 1998 p125Fak focal adhesion kinase is a substrate for the insulin and insulin-like growth factor-I tyrosine kinase receptors.
9506989 1998 Grb10 interacts differentially with the insulin receptor, insulin-like growth factor I receptor, and epidermal growth factor receptor via the Grb10 Src homology 2 (SH2) domain and a second novel domain located between the pleckstrin homology and SH2 domains.
9492017 1998 Interaction of Janus kinases JAK-1 and JAK-2 with the insulin receptor and the insulin-like growth factor-1 receptor.
9449692 1998 Two aberrant splicings caused by mutations in the insulin receptor gene in cultured lymphocytes from a patient with Rabson-Mendenhall's syndrome.
9446569 1998 Activation of P2Y2 receptors by UTP and ATP stimulates mitogen-activated kinase activity through a pathway that involves related adhesion focal tyrosine kinase and protein kinase C.
9428692 1997 Identification of Stat 5B as a substrate of the insulin receptor.
9398630 1997 A conserved region in the first intron of the insulin receptor gene binds nuclear proteins during adipocyte differentiation.
9355755 1997 Insulin receptor/IGF-I receptor hybrids are widely distributed in mammalian tissues: quantification of individual receptor species by selective immunoprecipitation and immunoblotting.
9355745 1997 Protein tyrosine phosphatase 1B interacts with and is tyrosine phosphorylated by the epidermal growth factor receptor.
9312016 1997 Crystal structure of the activated insulin receptor tyrosine kinase in complex with peptide substrate and ATP analog.
9299395 1997 Four mutant alleles of the insulin receptor gene associated with genetic syndromes of extreme insulin resistance.
9249867 1997 Molecular analysis of the insulin receptor gene for prenatal diagnosis of leprechaunism in two families.
9202395 1997 Distribution of insulin/insulin-like growth factor-I hybrid receptors in human tissues.
9199575 1997 The Val985Met insulin-receptor variant in the Danish Caucasian population: lack of associations with non-insulin-dependent diabetes mellitus or insulin resistance.
9197239 1997 ARF proteins mediate insulin-dependent activation of phospholipase D.
9195949 1997 Tyr624 and Tyr628 in insulin receptor substrate-2 mediate its association with the insulin receptor.
9175790 1997 Identification of two novel insulin receptor mutations, Asp59Gly and Leu62Pro, in type A syndrome of extreme insulin resistance.
9122188 1997 Stat5 is a physiological substrate of the insulin receptor.
9121430 1997 Tyrosine phosphorylation sites at amino acids 239 and 240 of Shc are involved in epidermal growth factor-induced mitogenic signaling that is distinct from Ras/mitogen-activated protein kinase activation.
9092559 1997 Insulin-induced activation of NADPH-dependent H2O2 generation in human adipocyte plasma membranes is mediated by Galphai2.
9092546 1997 Interaction of MAD2 with the carboxyl terminus of the insulin receptor but not with the IGFIR. Evidence for release from the insulin receptor after activation.
9083103 1997 Functional importance of Shc tyrosine 317 on insulin signaling in Rat1 fibroblasts expressing insulin receptors.
8999839 1997 Protein-tyrosine phosphatase 1B complexes with the insulin receptor in vivo and is tyrosine-phosphorylated in the presence of insulin.
8995282 1997 Functional association between the insulin receptor and the transmembrane protein-tyrosine phosphatase LAR in intact cells.
8916919 1996 Characterization of a hybrid receptor formed by dimerization of the insulin receptor-related receptor (IRR) with the insulin receptor (IR): coexpression of cDNAs encoding human IRR and human IR in NIH-3T3 cells.
8900242 1996 Association of the insulin-receptor variant Met-985 with hyperglycemia and non-insulin-dependent diabetes mellitus in the Netherlands: a population-based study.
8890729 1996 In-frame exon 2 deletion in insulin receptor RNA in a family with extreme insulin resistance in association with defective insulin binding: a case report.
8826975 1996 Protein tyrosine phosphatase 1B interacts with the activated insulin receptor.
8702728 1996 Functional importance of amino-terminal domain of Shc for interaction with insulin and epidermal growth factor receptors in phosphorylation-independent manner.
8702689 1996 Protein-tyrosine phosphatase 1B is a negative regulator of insulin- and insulin-like growth factor-I-stimulated signaling.
8692915 1996 The stress response to ionizing radiation involoves c-Abl-dependent phosphorylation of SHPTP1.
8662806 1996 Interaction of insulin receptor substrate-2 (IRS-2) with the insulin and insulin-like growth factor I receptors. Evidence for two distinct phosphotyrosine-dependent interaction domains within IRS-2.
8639568 1996 Identification of insulin-stimulated phosphorylation sites on calmodulin.
8636294 1996 Deletion of Asn281 in the alpha-subunit of the human insulin receptor causes constitutive activation of the receptor and insulin desensitization.
8626379 1996 Insulin receptor substrate-2 binds to the insulin receptor through its phosphotyrosine-binding domain and through a newly identified domain comprising amino acids 591-786.
8621530 1996 Interaction between the Grb10 SH2 domain and the insulin receptor carboxyl terminus.
8557631 1996 The beta-adrenergic receptor is a substrate for the insulin receptor tyrosine kinase.
8513978 1993 Glycosylation of Asn397 or Asn418 is required for normal insulin receptor biosynthesis and processing.
8504096 1993 Insulin receptor autophosphorylation. II. Determination of autophosphorylation sites by chemical sequence analysis and identification of the juxtamembrane sites.
8496180 1993 Insulin stimulates serine and tyrosine phosphorylation in the juxtamembrane region of the insulin receptor.
8463311 1993 The adipocyte lipid-binding protein at 1.6-A resolution. Crystal structures of the apoprotein and with bound saturated and unsaturated fatty acids.
8463287 1993 Interaction of the human insulin receptor tyrosine kinase from the baculovirus expression system with protein kinase C in a cell-free system.
8458533 1993 Patients with lipodystrophic diabetes mellitus of the Seip-Berardinelli type, express normal insulin receptors.
8454633 1993 Cloning and expression of PTP-PEST. A novel, human, nontransmembrane protein tyrosine phosphatase.
8452530 1993 Purified hybrid insulin/insulin-like growth factor-I receptors bind insulin-like growth factor-I, but not insulin, with high affinity.
8440175 1993 Ligand-binding properties of the two isoforms of the human insulin receptor.
8432414 1993 Methionine for valine substitution in exon 17 of the insulin receptor gene in a pedigree with familial NIDDM.
8419945 1993 Activation of glucose transport by a natural mutation in the human insulin receptor.
8390949 1993 A mutation (Trp1193-->Leu1193) in the tyrosine kinase domain of the insulin receptor associated with type A syndrome of insulin resistance.
8388389 1993 Antibodies to the extracellular receptor domain restore the hormone-insensitive kinase and conformation of the mutant insulin receptor valine 382.
8385099 1993 The alpha-type 85-kDa subunit of phosphatidylinositol 3-kinase is phosphorylated at tyrosines 368, 580, and 607 by the insulin receptor.
8347587 1993 Specific glycosylation site mutations of the insulin receptor alpha subunit impair intracellular transport.
8326490 1993 A syndrome of insulin resistance resembling leprechaunism in five sibs of consanguineous parents.
8314008 1994 Molecular scanning of the insulin receptor gene in syndromes of insulin resistance.
8288049 1994 Prevalence of mutations in the insulin receptor gene in subjects with features of the type A syndrome of insulin resistance.
8276809 1994 Direct activation of the phosphatidylinositol 3'-kinase by the insulin receptor.
8257688 1993 Characterization of human placental insulin-like growth factor-I/insulin hybrid receptors by protein microsequencing and purification.
8243830 1993 Ala1048-->Asp mutation in the kinase domain of insulin receptor causes defective kinase activity and insulin resistance.
8242067 1993 Substitution of Leu for Pro-193 in the insulin receptor in a patient with a genetic form of severe insulin resistance.
8188715 1994 A mutation in the insulin receptor that impairs proreceptor processing but not insulin binding.
8175972 1994 Deletion of exon 3 of the insulin receptor gene in a kindred with a familial form of insulin resistance.
8135823 1994 Insulin receptor kinase phosphorylates protein tyrosine phosphatase containing Src homology 2 regions and modulates its PTPase activity in vitro.
8114715 1994 Lck-dependent tyrosyl phosphorylation of the phosphotyrosine phosphatase SH-PTP1 in murine T cells.
8101305 1993 Homozygous nonsense mutation in the insulin receptor gene in infant with leprechaunism.
8096518 1993 Substitution of glutamic acid for alanine 1135 in the putative "catalytic loop" of the tyrosine kinase domain of the human insulin receptor. A mutation that impairs proteolytic processing into subunits and inhibits receptor tyrosine kinase activity.
8082780 1994 Functional properties of a heterozygous mutation (Arg1174-->Gln) in the tyrosine kinase domain of the insulin receptor from a type A insulin resistant patient.
8027066 1994 The functions of the human insulin receptor are affected in different ways by mutation of each of the four N-glycosylation sites in the beta subunit.
7997262 1994 Crystal structure of the tyrosine kinase domain of the human insulin receptor.
7983039 1994 Two naturally occurring mutations in the kinase domain of insulin receptor accelerate degradation of the insulin receptor and impair the kinase activity.
7935368 1994 Characterization of an interaction between insulin receptor substrate 1 and the insulin receptor by using the two-hybrid system.
7929343 1994 Phorbol ester stimulates phosphorylation on serine 1327 of the human insulin receptor.
7926007 1994 Identification of serines-1035/1037 in the kinase domain of the insulin receptor as protein kinase C alpha mediated phosphorylation sites.
7906861 1993 Serum alpha 2-HS-glycoprotein is an inhibitor of the human insulin receptor at the tyrosine kinase level.
7895674 1995 A functional assessment of insulin/insulin-like growth factor-I hybrid receptors.
7860063 1995 Two mutant alleles of the insulin receptor gene in a family with a genetic form of insulin resistance: a 10 base pair deletion in exon 1 and a mutation substituting serine for asparagine-462.
7836419 1995 Insulin stimulates the tyrosine dephosphorylation of pp125 focal adhesion kinase.
7815442 1994 Homozygosity for a new mutation (Ile119-->Met) in the insulin receptor gene in five sibs with familial insulin resistance.
7806540 1994 A mutant insulin receptor induces formation of a Shc-growth factor receptor bound protein 2 (Grb2) complex and p21ras-GTP without detectable interaction of insulin receptor substrate 1 (IRS1) with Grb2. Evidence for IRS1-independent p21ras-GTP formation.
7794689 1995 Structural and functional heterogeneity of insulin receptors.
7693131 1993 Homozygous deletion of the human insulin receptor gene results in leprechaunism.
7657032 1995 Frequency of mutations of insulin receptor gene in Japanese patients with NIDDM.
7626603 1995 Insulin-stimulated phosphorylation of recombinant pp120/HA4, an endogenous substrate of the insulin receptor tyrosine kinase.
7613486 1995 Glycosylation sites encoded by exon 2 of the human insulin receptor gene are not required for the oligomerization, ligand binding, or kinase activity of the insulin receptor.
7592607 1995 Receptor-mediated internalization of insulin. Potential role of pp120/HA4, a substrate of the insulin receptor kinase.
7559478 1995 Distinct modes of interaction of SHC and insulin receptor substrate-1 with the insulin receptor NPEY region via non-SH2 domains.
7556070 1995 Insulin stimulates the kinase activity of RAC-PK, a pleckstrin homology domain containing ser/thr kinase.
7538143 1995 Two mutations in the insulin receptor gene of a patient with leprechaunism: application to prenatal diagnosis.
7537849 1995 Phosphotyrosine-dependent interaction of SHC and insulin receptor substrate 1 with the NPEY motif of the insulin receptor via a novel non-SH2 domain.
7535775 1995 Insulin-dependent tyrosine phosphorylation of the vav protooncogene product in cells of hematopoietic origin.
7529876 1995 Tyrosine phosphorylation of focal adhesion kinase at sites in the catalytic domain regulates kinase activity: a role for Src family kinases.
7512963 1994 Insulin stimulates the phosphorylation of Tyr538 and the catalytic activity of PTP1C, a protein tyrosine phosphatase with Src homology-2 domains.
7493946 1995 Adapter function of protein-tyrosine phosphatase 1D in insulin receptor/insulin receptor substrate-1 interaction.
7479769 1995 Grb-IR: a SH2-domain-containing protein that binds to the insulin receptor and inhibits its function.
7028018 1981 The erythrocyte insulin receptor.
6849137 1983 Insulin receptor: evidence that it is a protein kinase.
3680248 1987 Characterization of the promoter region of the human insulin receptor gene. Evidence for promoter activity.
3546306 1987 Nuclear translocation of the insulin receptor. A possible mediator of insulin's long term effects.
3518947 1986 Replacement of insulin receptor tyrosine residues 1162 and 1163 compromises insulin-stimulated kinase activity and uptake of 2-deoxyglucose.
3447155 1987 Partial amino acid sequence analyses of human placental insulin receptor.
3283938 1988 Insulin-resistant diabetes due to a point mutation that prevents insulin proreceptor processing.
3166375 1988 Studies on the autophosphorylation of the insulin receptor from human placenta. Analysis of the sites phosphorylated by two-dimensional peptide mapping.
3109943 1987 Interaction of the human insulin receptor with the ras oncogene product p21.
3101064 1987 Replacement of lysine residue 1030 in the putative ATP-binding region of the insulin receptor abolishes insulin- and antibody-stimulated glucose uptake and receptor kinase activity.
2986535 1985 Uptake of insulin and other ligands into receptor-rich endocytic components of target cells: the endosomal apparatus.
2983222 1985 Human insulin receptor and its relationship to the tyrosine kinase family of oncogenes.
2859121 1985 The human insulin receptor cDNA: the structural basis for hormone-activated transmembrane signalling.
2842060 1988 Mutation of the insulin receptor at tyrosine 960 inhibits signal transmission but does not affect its tyrosine kinase activity.
2834824 1988 Two mutant alleles of the insulin receptor gene in a patient with extreme insulin resistance.
2806055 1989 Characterization of the promoter region of the human insulin receptor gene.
2777789 1989 Characterization of the promoter region and 3' end of the human insulin receptor gene.
2573522 1989 A mutation in the insulin receptor gene that impairs transport of the receptor to the plasma membrane and causes insulin-resistant diabetes.
2566545 1989 Molecular and clinical characterization of an insertional polymorphism of the insulin-receptor gene.
2550426 1989 Mutation of the high cysteine region of the human insulin receptor alpha-subunit increases insulin receptor binding affinity and transmembrane signaling.
2544998 1989 Human diabetes associated with a mutation in the tyrosine kinase domain of the insulin receptor.
2544997 1989 Human diabetes associated with a deletion of the tyrosine kinase domain of the insulin receptor.
2538124 1989 Alternative splicing of human insulin receptor messenger RNA.
2479553 1989 A leucine-to-proline mutation in the insulin receptor in a family with insulin resistance.
2460770 1988 Detection of an alteration in the insulin-receptor gene in a patient with insulin resistance, acanthosis nigricans, and the polycystic ovary syndrome (type A insulin resistance).
2369896 1990 Functionally distinct insulin receptors generated by tissue-specific alternative splicing.
2365819 1990 Five mutant alleles of the insulin receptor gene in patients with genetic forms of insulin resistance.
2280779 1990 Structural and functional analysis of the insulin receptor promoter.
2211730 1990 Substructural analysis of the insulin receptor by microsequence analyses of limited tryptic fragments isolated by sodium dodecyl sulfate-polyacrylamide gel electrophoresis in the absence or presence of dithiothreitol.
2210055 1990 Human insulin-receptor gene. Partial sequence and amplification of exons by polymerase chain reaction.
2168397 1990 A naturally occurring mutation of insulin receptor alanine 1134 impairs tyrosine kinase function and is associated with dominantly inherited insulin resistance.
2121734 1990 Substitution of lysine for asparagine at position 15 in the alpha-subunit of the human insulin receptor. A mutation that impairs transport of receptors to the cell surface and decreases the affinity of insulin binding.
2040394 1991 Detection of mutations in insulin-receptor gene in NIDDM patients by analysis of single-stranded conformation polymorphisms.
2002058 1991 Insulin resistance and diabetes due to different mutations in the tyrosine kinase domain of both insulin receptor gene alleles.
1993068 1991 Mapping of carbohydrate sites on the human insulin receptor.
1986371 1991 A model for the quaternary structure of human placental insulin receptor deduced from electron microscopy.
1971035 1990 Insulin-resistant diabetes associated with partial deletion of insulin-receptor gene.
1963473 1990 Functional properties of a naturally occurring Trp1200----Ser1200 mutation of the insulin receptor.
1956339 1991 Protein kinase phosphorylation site sequences and consensus specificity motifs: tabulations.
1898103 1991 The native alpha 2 beta 2 tetramer is the only subunit structure of the insulin receptor in intact cells and purified receptor preparations.
1890161 1991 A mutation in the tyrosine kinase domain of the insulin receptor associated with insulin resistance in an obese woman.
1730625 1992 An Arg for Gly substitution at position 31 in the insulin receptor, linked to insulin resistance, inhibits receptor processing and transport.
1657953 1991 Substitution of arginine for histidine at position 209 in the alpha-subunit of the human insulin receptor. A mutation that impairs receptor dimerization and transport of receptors to the cell surface.
1648089 1991 In vitro phosphorylation of the adipocyte lipid-binding protein (p15) by the insulin receptor. Effects of fatty acid on receptor kinase and substrate phosphorylation.
1644241 1992 Abnormal messenger ribonucleic acid (mRNA) transcribed from a mutant insulin receptor gene in a patient with type A insulin resistance.
1607076 1992 NIDDM associated with mutation in tyrosine kinase domain of insulin receptor gene.
1607067 1992 Detection of mutations in insulin receptor gene by denaturing gradient gel electrophoresis.
1563582 1992 Detection of mutations in the insulin receptor gene in patients with insulin resistance by analysis of single-stranded conformational polymorphisms.
1472036 1992 Identification of a disulfide bridge connecting the alpha-subunits of the extracellular domain of the insulin receptor.
1470163 1992 [Insulin receptor Arg1131-->Gln: a novel mutation in the catalytic loop of insulin receptor observed in insulin resistant diabetes].
1373652 1992 Sequential dephosphorylation of a multiply phosphorylated insulin receptor peptide by protein tyrosine phosphatases.
1331107 1992 Interaction between the p21ras GTPase activating protein and the insulin receptor.
1324934 1992 Transcriptional regulation of the human insulin receptor promoter.
1321605 1992 Analysis of the order of autophosphorylation of human insulin receptor tyrosines 1158, 1162 and 1163.
1321126 1992 Insulin receptor protein-tyrosine phosphatases. Leukocyte common antigen-related phosphatase rapidly deactivates the insulin receptor kinase by preferential dephosphorylation of the receptor regulatory domain.
1315125 1992 Reduced mRNA and a nonsense mutation in the insulin-receptor gene produce heritable severe insulin resistance.
1314826 1992 Substitution of isoleucine for methionine at position 1153 in the beta-subunit of the human insulin receptor. A mutation that impairs receptor tyrosine kinase activity, receptor endocytosis, and insulin action.
1304913 1992 Identification of the adipocyte acid phosphatase as a PAO-sensitive tyrosyl phosphatase.
185872 1976 A study of insulin receptors in human mononuclear leucocytes.