Property Summary

NCBI Gene PubMed Count 10
PubMed Score 14.42
PubTator Score 5.32

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
astrocytic glioma -1.300 3.0e-02
atypical teratoid / rhabdoid tumor -1.100 8.7e-04
medulloblastoma, large-cell -1.100 3.1e-05
osteosarcoma 1.055 8.5e-03
tuberculosis and treatment for 6 months -1.200 4.5e-05

Synonym

Accession Q9NRY2 Q5VWJ7 Q96E04 Q9P090
Symbols MISE
SOSSC
SSBIP1
C9orf80
HSPC043
hSSBIP1

Gene

PDB

4OWT   4OWW  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (3)

AA Sequence

MAANSSGQGFQNKNRVAILAELDKEKRKLLMQNQSSTNHPGASIALSRPSLNKDFRDHAEQQHIAAQQKA      1 - 70
ALQHAHAHSSGYFITQDSAFGNLILPVLPRLDPE                                         71 - 104
//

Text Mined References (12)

PMID Year Title