Property Summary

NCBI Gene PubMed Count 10
PubMed Score 7.96
PubTator Score 5.32

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
astrocytic glioma -1.300 3.0e-02
osteosarcoma -1.323 3.3e-05
atypical teratoid / rhabdoid tumor -1.100 8.7e-04
medulloblastoma, large-cell -1.200 3.4e-04
tuberculosis and treatment for 6 months -1.200 4.5e-05

Synonym

Accession Q9NRY2 Q5VWJ7 Q96E04 Q9P090
Symbols MISE
SOSSC
SSBIP1
C9orf80
HSPC043
hSSBIP1

Gene

PDB

4OWT   4OWW  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (3)

PMID Text
19786574 MISE is part of the INTS3/MISE/hSSB1 (IMS1) complex, which controls the DNA damage response
19683501 SOSS-C is part of an ssDNA-binding heterotrimeric complex, SOSS which is involved in the maintenance of genome stability.
19605351 hSSBIP1 forms complexes with INTS3/hSSB1 and INTS3/hSSB2 and participates in the DNA damage response

AA Sequence

MAANSSGQGFQNKNRVAILAELDKEKRKLLMQNQSSTNHPGASIALSRPSLNKDFRDHAEQQHIAAQQKA      1 - 70
ALQHAHAHSSGYFITQDSAFGNLILPVLPRLDPE                                         71 - 104
//

Text Mined References (12)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
19786574 2009 INTS3 controls the hSSB1-mediated DNA damage response.
19683501 2009 SOSS complexes participate in the maintenance of genomic stability.
19605351 2009 HSSB1 and hSSB2 form similar multiprotein complexes that participate in DNA damage response.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18449195 2008 Single-stranded DNA-binding protein hSSB1 is critical for genomic stability.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11042152 2000 Cloning and functional analysis of cDNAs with open reading frames for 300 previously undefined genes expressed in CD34+ hematopoietic stem/progenitor cells.