Property Summary

NCBI Gene PubMed Count 10
PubMed Score 14.42
PubTator Score 5.32

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
astrocytic glioma -1.300 3.0e-02
atypical teratoid / rhabdoid tumor -1.100 8.7e-04
medulloblastoma, large-cell -1.100 3.1e-05
osteosarcoma 1.055 8.5e-03
tuberculosis and treatment for 6 months -1.200 4.5e-05

Gene RIF (3)

AA Sequence

MAANSSGQGFQNKNRVAILAELDKEKRKLLMQNQSSTNHPGASIALSRPSLNKDFRDHAEQQHIAAQQKA      1 - 70
ALQHAHAHSSGYFITQDSAFGNLILPVLPRLDPE                                         71 - 104
//

Text Mined References (12)

PMID Year Title