Property Summary

NCBI Gene PubMed Count 11
PubMed Score 18.10
PubTator Score 12.62

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q0VD86 Q6J273 Q6PKN9
Symbols HSD45

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA Inparanoid

Gene RIF (2)

AA Sequence

MQVQDDGVNLIPFAKCSRVVSRSPPPRLPSQSLRPMPQRYGDVFWKNLNQRPTPTWLEEQHIPPMLRATG      1 - 70
CSQLGLYPPEQLPPPEMLWRRKKRRPCLEGMQQQGLGGVPARVRAVTYHLEDLRRRQSIINELKKAQWGS     71 - 140
SGAASEPVVLGEEGCGFPSTNEYPDLEEERATYPQEEDRFLTPGRAQLLWSPWSPLDQEEACASRQLHSL    141 - 210
ASFSTVTARRNPLHNPWGMELAASEE                                                211 - 236
//

Text Mined References (12)

PMID Year Title