Property Summary

NCBI Gene PubMed Count 100
PubMed Score 146.52
PubTator Score 125.79

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
adrenocortical carcinoma 1.029 4.7e-04
astrocytoma 1.100 8.7e-16
Astrocytoma, Pilocytic 1.200 2.5e-06
atypical teratoid / rhabdoid tumor 2.300 8.0e-11
colon cancer 1.300 3.0e-05
dermatomyositis 1.300 1.4e-03
ependymoma 1.400 1.0e-02
gastric carcinoma 1.200 2.7e-02
glioblastoma 1.700 1.7e-08
group 3 medulloblastoma 1.600 5.4e-03
lung adenocarcinoma 1.451 3.8e-07
lung cancer 1.300 6.7e-03
medulloblastoma, large-cell 2.900 1.8e-07
Multiple myeloma 1.073 1.9e-03
oligodendroglioma 1.600 2.3e-02
osteosarcoma -1.154 4.2e-04
ovarian cancer -1.300 4.8e-04
pediatric high grade glioma 1.600 6.0e-07
primitive neuroectodermal tumor 2.100 1.2e-07
psoriasis -1.800 1.2e-04
subependymal giant cell astrocytoma -1.302 1.9e-02
Waldenstrons macroglobulinemia 1.007 1.4e-02

Synonym

Accession Q12906 A8K6F2 G5E9M5 O43409 Q6P1X1 Q86XY7 Q99544 Q99545 Q9BZH4 Q9BZH5 Q9NQ95 Q9NQ96 Q9NQ97 Q9NQ98 Q9NQ99 Q9NQA0 Q9NQA1 Q9NQA2 Q9NRN2 Q9NRN3 Q9NRN4 Q9UMZ9 Q9UN00 Q9UN84 Q9UNA2
Symbols CBTF
DRBF
MMP4
MPP4
NF90
NFAR
NF110
NF90a
NF90b
NFAR2
TCP80
DRBP76
NF110b
NFAR-1
TCP110
MPHOSPH4
NF-AT-90

Gene

Gene RIF (60)

AA Sequence

MRPMRIFVNDDRHVMAKHSSVYPTQEELEAVQNMVSHTERALKAVSDWIDEQEKGSSEQAESDNMDVPPE      1 - 70
DDSKEGAGEQKTEHMTRTLRGVMRVGLVAKGLLLKGDLDLELVLLCKEKPTTALLDKVADNLAIQLAAVT     71 - 140
EDKYEILQSVDDAAIVIKNTKEPPLSLTIHLTSPVVREEMEKVLAGETLSVNDPPDVLDRQKCLAALASL    141 - 210
RHAKWFQARANGLKSCVIVIRVLRDLCTRVPTWGPLRGWPLELLCEKSIGTANRPMGAGEALRRVLECLA    211 - 280
SGIVMPDGSGIYDPCEKEATDAIGHLDRQQREDITQSAQHALRLAAFGQLHKVLGMDPLPSKMPKKPKNE    281 - 350
NPVDYTVQIPPSTTYAITPMKRPMEEDGEEKSPSKKKKKIQKKEEKAEPPQAMNALMRLNQLKPGLQYKL    351 - 420
VSQTGPVHAPIFTMSVEVDGNSFEASGPSKKTAKLHVAVKVLQDMGLPTGAEGRDSSKGEDSAEETEAKP    421 - 490
AVVAPAPVVEAVSTPSAAFPSDATAEQGPILTKHGKNPVMELNEKRRGLKYELISETGGSHDKRFVMEVE    491 - 560
VDGQKFQGAGSNKKVAKAYAALAALEKLFPDTPLALDANKKKRAPVPVRGGPKFAAKPHNPGFGMGGPMH    561 - 630
NEVPPPPNLRGRGRGGSIRGRGRGRGFGGANHGGYMNAGAGYGSYGYGGNSATAGYSQFYSNGGHSGNAS    631 - 700
GGGGGGGGGSSGYGSYYQGDNYNSPVPPKHAGKKQPHGGQQKPSYGSGYQSHQGQQQSYNQSPYSNYGPP    701 - 770
QGKQKGYNHGQGSYSYSNSYNSPGGGGGSDYNYESKFNYSGSGGRSGGNSYGSGGASYNPGSHGGYGGGS    771 - 840
GGGSSYQGKQGGYSQSNYNSPGSGQNYSGPPSSYQSSQGGYGRNADHSMNYQYR                    841 - 894
//

Text Mined References (114)

PMID Year Title