Property Summary

NCBI Gene PubMed Count 314
PubMed Score 257.99
PubTator Score 675.74

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Expression

  Differential Expression (23)

Disease log2 FC p
malignant mesothelioma 2.300 2.6e-06
osteosarcoma -2.039 3.5e-03
group 4 medulloblastoma -2.300 4.2e-06
atypical teratoid/rhabdoid tumor -1.600 1.9e-05
glioblastoma 1.200 4.8e-02
medulloblastoma, large-cell -2.800 4.8e-07
acute quadriplegic myopathy 1.130 4.3e-04
pancreatic ductal adenocarcinoma liver m... -1.677 1.3e-03
tuberculosis and treatment for 6 months -1.500 5.4e-05
non-small cell lung cancer -1.745 8.1e-17
intraductal papillary-mucinous adenoma (... 1.700 1.4e-02
lung cancer -5.900 2.3e-06
colon cancer -2.400 6.3e-05
pilocytic astrocytoma 1.500 1.6e-05
primary Sjogren syndrome 1.200 3.5e-02
subependymal giant cell astrocytoma 2.163 5.1e-03
lung carcinoma -1.300 6.1e-20
Pick disease 1.400 1.4e-02
Breast cancer -1.100 3.3e-06
invasive ductal carcinoma -1.500 6.9e-03
ulcerative colitis -1.300 1.2e-04
ovarian cancer -1.100 3.1e-02
pituitary cancer -3.400 6.4e-08

Gene RIF (290)

PMID Text
26997259 results provide evidence that two IL6R gene polymorphisms rs2228145 C and rs12083537 G are associated with poor lung function in patients with asthma. Furthermore, the rs2228145 A-C variant is associated with levels of sIL-6R and IgE.
26782593 While prior studies have found an association between PDE4D and IL6R polymorphisms and ischemic stroke, the results of this study suggest that this association may be different in a hypertensive population.
26714766 This is the first study to investigate the effects of functional two polymorphisms on IL-6 and IL-6R genes in a pediatric patient group with AA risk.
26699882 High serum IL-6R levels were associated with Chronic Spontaneous Urticaria.
26563755 Authors identified miR-125a as a direct regulator of IL-6R, and the genotype of rs12976445 might be a novel predictor of the development of DN in DM.
26424054 miR-125a-5p directly targets IL-6R and STAT3 expression in HEK-293T cells.
26359498 established that endogenous IL-6R of both human and murine origin is shed by ADAM17 in an induced manner, whereas constitutive release of endogenous IL-6R is largely mediated by ADAM10
26329582 findings identify TRAF3 and PTPN22 as inhibitors of IL-6R signaling in B cells and reveal a previously uncharacterized role for TRAF3 in the regulation of plasma cell differentiation
26205065 The serum levels of VEGF, IL-17, IL-10 and TNF-alpha were lower in the pregnant women with PE when compared with their normotensive peers, while the IL-6 levels were higher
26200663 obesity was a positive modulator of IL-6R and IL-6 expression in the adipose tissue which might be a contributory mechanism to induce metabolic inflammation.
26198920 Single nucleotide polymorphisms in IL6R were not associated with increased risk for schizophrenia in a Polish population.
26086344 Interleukin-6 is strongly affected by factors associated with obesity accounting for its lability and responsiveness to diet, life style and contemporaneous events.
26080005 Data suggest that targeting interactions of interleukin-6 (IL6) and interleukin-6 receptors (IL6R) provides effective treatment in autoimmune diseases and cancers. [REVIEW]
25973020 It was predicted that interleukin-6-receptor (IL6R) was a potential target gene of miR-34a by bioinformatics analysis and identified by luciferase assay. It was further showed that miR-34a inhibited oral cancer progression via IL6R
25930193 Experimental asthma associated with both high IL-6 and high sIL-6R levels in the airways is attenuated by treatment with IL-6R inhibitors.
25910182 Elevated levels of sIL6R were associated with the risk of myocardial infarction and serum levels of sgp130 seemed to modify this association.
25846075 Data suggest secreted FRP3 (frizzled related protein-3) interacts with ADAM17 (A disintegrin/metalloprotease 17) substrate IL6R (interleukin-6 receptor) release; this interaction is down-regulated in osteoarthritis due to rare double variant in FRP3.
25813875 The IL-6R variant interacted with the previously reported COL5A1 and BGN variants to modulate carpal tunnel syndrome risk.
25792278 The aim of this study was to investigate the association of soluble IL-6R levels with myocardial reperfusion after percutaneous coronary intervention (PCI) for acute ST-elevated myocardial infarction.
25781951 IL6R haplotypes regulate the circulating levels of inflammatory biomarkers and lack association with the risk of CHD.
25658637 Interleukin 6 receptor is an independent prognostic factor and a potential therapeutic target of ovarian cancer
25524550 The rs4845625 of IL6R may be a susceptibility locus for chronic kidney disease in Japanese individuals.
25491772 Increased expression of the Th17-IL-6R/pSTAT3/BATF/RorgammaT-axis in the tumoural region of adenocarcinoma as compared to squamous cell carcinoma of the lung
25345743 Describe a novel cell-based screening assay for identifying small molecule IL-6R antagonists.
25335739 In overall analysis, high circulating C-reactive protein (CRP) and interleukin-6 (IL-6) level were significantly associated with shorter OS in NSCLC
25245339 In obese children and adolescents, insulin resistance is associated with elevated levels of IL-6 and diminished values of sIL-6R.
25183374 In COPD patients there was enhanced airway generation of soluble interleukin-6 receptor.
25176527 soluble IL-6R expression upregulated the levels of its own ligand, IL-6 and those of the pro-inflammatory cytokine IL-32.
25058889 Anti-IL-6R antibody prevented the early loss of intrahepatic islet grafts mediated by HMGB1-induced immune activation after islet transplantation.
25052265 IL6 and IL6R variants are not associated with metabolic syndrome or with any of its phenotypes.
25041016 A close association between an IL-6R polymorphism and cholangiocarcinoma.
24993179 IL-6 and IL-6R have an additional role in colitis.
24986424 Studies indicate that the interleukin-6 (IL-6)/soluble forms of the IL-6R (sIL-6R)/soluble forms of glycoprotein 130 (sgp130) system as highly dynamic and regulated signal pathway.
24978393 Interleukin-6-receptor polymorphisms rs12083537, rs2228145, and rs4329505 may have a role in response to tocilizumab in rheumatoid arthritis
24971337 The goal of our study is to test the association of IL6R rs7529229 polymorphism with coronary heart disease through a case-control study in Han Chinese population and a meta-analysis.
24940886 A variant of the IL6R gene, rs4845625, was found confer risk to atrial fibrillation recurrence after catheter ablation in a Chinese Han population.
24939178 IL6 stimulated SOD2 expression that, at least partially, contributed to the low level of ROS that would likely result in a sustained increase in the expression of IGF-1R through abolishment of beta-arrestin1 in docetaxel resistant cells.
24898204 All patients presented the putative KS-predisposing G-174C allele of the IL-6 promoter, the wife presenting a homozygosis and the newly affected relatives a heterozygosis, respectively
24886605 Carriers of the rs1800795 ( IL-6, promoter) G/G and rs8192284 (IL-6R )C/C genotypes showed the worst overall survival
24878322 The interleukin-6 receptor Asp358Ala single nucleotide polymorphism rs2228145 confers increased proteolytic conversion rates by ADAM proteases.
24806843 Data show that IL-6 receptor and Stat3 were highly expressed in human cervical squamous cell carcinoma tissues.
24802752 R28E mutation in CNTF abrogatesIL-6 receptor-dependent but retains CNTF receptor-dependent signaling via glycoprotein 130/ LIFR.
24791950 variance of sIL-6R levels can be explained by other variants in the IL6R region, including variants at the 3'-end of IL6R tagged by rs60760897 that are associated with IL6R RNA expression.
24790088 identified the region in IL-6R that binds to CANDIS. In contrast to the type I transmembrane proteins, the IL-6R, and IL-1RII, CANDIS does not bind the type II transmembrane protein TNF-alpha, demonstrating differences in the respective shedding by ADAM17
24772425 By tag-SNP genotyping based case-control study, we identified a genetic polymorphism in the IL-6R 3'UTR that regulates host resistance to pediatric TB in a Chinese population.
24717336 the presence of the IL-6R 358Ala allele in aortic valve stenosis patients is associated with attenuated systemic inflammatory state and less severe aortic valve stenosis
24710939 IL-6R antibody could significantly increase the expression of OPG, but inhibit the expression of RANKL, which might provide a theoretical basis of molecular biology for the prevention and treatment of aseptic loosening of prosthesis.
24699044 The present study suggests that IL-6R rs7529229 T/C functional SNP may contribute to the risk of Left main coronary artery disease in a Chinese population.
24668548 The present study supports the view that variants in the rs6684439 SNP of IL-6R is associated with a lower risk of HBV-related HCC, and this could provide valuable clues to understanding the mechanisms underlying susceptibility to this malignant disease.
24642471 IL-6R/STAT3/miR-34a feedback loop was present in primary colorectal tumors as well as CRC, breast, and prostate cancer cell lines and associated with a mesenchymal phenotype.
24498998 no association between genetic polymorphism and Henoch-Schonlein purpura in Spain
24445140 miR-451 behaves as a tumor suppressor, probably by targeting the IL6R pathway
24429361 Hepatitis C virus-induced changes in miRNA-449a and miRNA-107 regulate CCL2 expression by activation of the IL-6-mediated signaling cascade by targeting components of the interleukin-6 receptor complex.
24346288 Anti-IL6 receptor antibody targeting stromal tissue.
24285563 findings suggest that peripheral sIL-6R level is a potential indicator of affective severity in patients with bipolar disorder.
24285489 gene polymorphism (rs2228145) as a predictor of cardiovascular mortality in inflammatory polyarthritis
24165468 data suggest that the receptors for IL-6 and TNFalpha, rather than the cytokines themselves, may be better indicators of early vascular changes that are associated with cardiovascular diseases
24162774 HIV-1 gp120 upregulates the expression of interleukin 6 receptor (IL6R) in human B cells
24152848 Upon activation by thrombin or calcium ionophore A23187, but not by ADP, the IL-6R-alpha is released in soluble form, while cangrelor, the specific inhibitor of P2Y12 receptor, can partially inhibit sIL-6R release
24140252 no significant effects on group differences or effects of exercise interventions for most of the biological parameters, that is, IL-6, neopterin, 5-HIAA and tryptophan
24118365 Strong IL-6R expression is associated with poor response to therapy in multiple myeloma patients and may be used as a prognostic marker.
24114630 Our findings showed a significant statistical association between IL-6 -174 G/C SNP and PCOS risk in South Indian women. T
24032723 IL-6 plays a role in spontaneous miscarriage irrespectively of its type, however, no correlation between circulating IL-6 and IL6 gene polymorphism, as well as IL-6 and IL-6R polymorphisms associations with spontaneous miscarriage were revealed.
23945879 rs12083537:A allele significantly increased asthma risk.
23935104 identify the transcription factor Twist1 as a component of a STAT3-induced feedback loop that controls IL-6 signals by directly repressing Il6ra.
23926072 This is the first report demonstrating that heterodimeric combinations of IL-2R and IL-6R subunits are functional for signaling
23902164 Serum levels of sIL-6R were lower in patients with estrogen receptor-positive cancer; higher serum levels of sIL-6R at diagnosis were associated with significantly shorter relapse-free survival in patients with estrogen receptor-positive breast cancer
23782174 up-regulated in late onset severe pre-eclampsia
23771909 study reports gene expression in skeletal muscle tissue of women with metabolic syndrome is enriched in inflammatory response-related genes; IL6R, HDAC9 and CD97 expression correlated negatively with insulin sensitivity; suggests a role for these 3 inflammatory genes in development of skeletal muscle insulin resistance in women
23677452 dynamics of monocyte expression of VCAM-1r, ICAM-1r, and IL-6r following myocardial infarct and their relation to inflammatory cytokines, fibrinolytic factors and annexin V-binding microparticles
23658720 IL-6R overexpression, coupled with enhanced IL-6/STAT3 signaling may facilitate the malignant transformation of EBV-infected epithelial cells.
23648090 Esophageal squamous cell carcinoma patients with an increased serum level of sIL6R are predicted to respond poorly to preoperative chemoradiotherapy.
23594084 These data suggest that genetic polymorphisms of IL-6RA gene may be associated with disease phenotypes of systemic lupus erythematosus in Korean.
23593036 Our findings elucidate the regulation of IL-6 signaling by IL-6R, which is causally relevant to several complex diseases, identify mechanisms for new approaches to target the IL-6/IL-6R axis
23582716 IL-6 and soluble interleukin-6 receptor are associated with acute myocardial infarction and cardiac injury.
23582566 We identified a functional genetic variant in IL6R influencing disease prognosis and specifically predisposing to persistent atopic dermatitis.
23564454 a dual role of the IL-6R stalk region in IL-6 signaling.
23479153 Asp358Ala (48867A>C) IL6R polymorphism of the A allele is a possible genetic risk factor for MetS; Genotypes AA and AC had a better response to lifestyle modification intervention compared to CC genotype
23433353 Our results suggest that the IL-6R polymorphism may contribute to genetic susceptibility to chronic periodontitis in Northwestern Chinese Han population
23428306 Serum IL6 (interleukin 6), sIL6R (soluble interleukin 6 receptor), and sGP130 (soluble interleukin 6 signal transducer) are elevated in metabolic syndrome and are associated with markers of endothelial dysfunction/arterial stiffness/atherosclerosis.
23375120 Alternative splicing and proteolytic cleavage participate in soluble IL-6R generation in rheumatoid arthritis.
23242610 High soluble receptor of interleukin-6 expression is associated with multiple myeloma.
23199226 Increased IL-6 in anorexia nervosa (AN) seems to be compensated by the changes in sIL-6R and sgp130, which are directed towards inhibition of IL-6 action. The balance between these factors might play a role in the regulation of energy expenditure in AN.
23094986 The IL-6R 48892 A/C polymorphism is associated with high TG and WC, and low HDL-C levels in adolescents
23078005 Analysis of the IL6R Asp358Ala polymorphism showed that carriers of the AA genotype had a 2.5-fold lower risk for mastocytosis than those with the AC or CC genotypes.
23073775 No evidence of an association between IL6R polymorphisms, rs7529229 or rs2228145, with premature coronary heart disease in the Chinese Han population.
22984080 Acute signaling through IL-6R or CD40 integrates with chronic B-cell receptor(BCR)-mediated ERK kinase activation to restrict p-ERK from the B-cell nucleus.
22911828 Soluble interleukin-6 receptor induces motor stereotypies and co-localizes with gp130 in regions linked to cortico-striato-thalamo-cortical circuits
22742541 The functional genetic variants rs8192284 and rs2228044 located within the IL-6 receptor (IL-6R) subunits IL6R and IL6ST genes, respectively, are not involved in the susceptibility to systemic sclerosis
22642608 Type 1 diabetes in Chilean women appeared to be associated with the presence of the Asp allele in IL6 receptor. The IL6 receptor polymorphism (Asp358/Asp) was associated with body mass index in type 1 diabetes.
22554704 The IL6R coding SNP rs2228145 (Asp358Ala) is a potential modifier of lung function in subjects with asthma and might identify subjects at risk for more severe asthma.
22552503 IL-6R is present in cancer stem cells and has an important role in the proliferation
22449275 IL-6-634 polymorphism G allele is an aggravating factor of bronchopulmonary dysplasia. IL-6-634 polymorphism is not associated with periventricular leukomalacia
22421339 We assessed Asp358Ala in relation to localised gene expression and to postlipopolysaccharide stimulation of interleukin 6.
22295972 IL6R alpha is co-localized with melanin-concentrating hormone in the hypothalamus.
22209080 Elevated urinary concentrations of IL6, sIL6R, TNFR1 and sVCAM-1 clearly indicate an early acute transplant rejection.
22133618 Improvement of sleep quality after tocilizumab treatment in patients with RA does not appear to directly result from decreased disease activity, suggesting that aberrant IL-6 receptor regulation is associated with sleep disturbances.
22128229 Single nucleotide polymorphisms rs1143634 of IL-1beta and rs8192284 of IL-6 receptor act as susceptibility variations in Korean non-Sjogren dry eye patients.
22079540 No significant associations were found among IL-6 genotype and the related cytokine serum levels as risk factor for sepsis development in burned patients
22072558 High serum IL-6 Receptor and single nucleotide polymorphism along with 1q21 amplification is associated with multiple myeloma
21989726 The IL-6 classic- and trans-signaling pathways have an important role in corneal sterile inflammation and wound healing.
21981268 results do not confirm an association of IL6R rs2228145 and IL6ST/gp130 rs2228044 polymorphisms with CV disease in RA.
21968316 Report improved endothelial dysfunction and aortic stiffness in rheumatoid arthritis patients treated with Il-6 receptor antibody.
21907864 associated with asthma risk
21879314 Verbal intelligence quotient in Asp homozygotes was significantly higher compared to Ala carriers. Compared to Ala carriers, Asp homozygotes performed better in the verbal subtests requiring long-term memory stores.
21851175 Functional genetic variations in the IL6, IL6R, and IL8 genes were not associated with delirium.
21846873 It was identified genetic association in Interleukin-6 Receptors with atrial fibrillation in whites.
21835044 genetic association studies in adolescent population in Taiwan: SNPs in IL6R (rs8192284 A/C; rs2229238 C/T) are associated with dyslipidemias (and risk of atherosclerosis) among adolescents (ages 12-14 years) in girls, but not in boys.
21813064 Anti-IL-6 receptor antibody (tocilizumab) results in induction/expansion of B regulatory cells in rheumatoid arthritis patients.
21748280 This study showed that there were statistically significant differences in genotype distribution of IL-6 -174 G/C between AD cases and controls in recessive model (CC versus GC + GG).
21700295 Data show that the presence of schizophrenia is associated with elevated IL-6 levels, whereas sIL-6R levels are mainly predetermined by the Asp358Ala genotype and are not associated with the disease status.
21515913 using a panel of PC cells with varying MSLN/IL-6 expressions, we showed that MSLN/IL-6 axis is a major survival axis in PC supporting tumor cell growth under anchorage-dependent and independent conditions
21496483 Even after exclusion of depressed individuals neither the SNPs nor the mRNA IL1beta and IL6R expression levels were associated with chronic or persistent fatigue in breast cancer survivors.
21490132 Celecoxib inhibits interleukin-6/interleukin-6 receptor-induced JAK2/STAT3 phosphorylation in human hepatocellular carcinoma cells
21401300 Maximum post-operative concentrations of hepcidin correlated positively with maximum IL-6 levels
21295508 Circulating sIL-6R and CD4+ IL-6R+ T cells were increased in chronic hepatitis B patients.
21282511 The IL-6/soluble IL-6 receptor complex enables activation of cells expressing solely gp130 during trans-signaling in normal gestation and during pregnancy complicated by intra-amniotic inflammation.
21255427 Comparison of peripheral blood mononuclear cells from highly trained atheletes and sedentary subjects shows no difference in expression levels of IL-6R.
21229891 Exposing Caco-2 cells to increasing doses of phytic acid increased Il6/Il6R transcript levels.
21220034 Increased copy number of the interleukin-6 receptor gene is associated with adverse survival in multiple myeloma patients treated with autologous stem cell transplantation.
21196890 IL-6 plays a role on aggressive behaviour of ameloblastomas and keratocystic odontogenic tumors by making easy bone resorption
21173340 Data suggest that increased plasma soluble gp130/soluble IL-6R/IL-6 ratio and reduced membrane transsignaling gp130 expression could contribute to decreased SOCS-3 expression and subsequent reduction in SOCS-3 antiinflammatory activity in preeclampsia.
21159831 Data show that radiographic damage in patients with chronic gouty arthritis is negatively associated with serum sIL-6 receptor and osteoprotegerin.
20974296 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20951753 polymorphisms in the 5' area of the IL-6R gene may be associated with increased susceptibility to respiratory infections
20951753 Observational study of gene-disease association. (HuGE Navigator)
20856253 Boys who carry the GG genotype of CRP +2147 A/G and the CC genotype of IL-6R rs2229238 C/T have a greater risk of having abnormal body size and of developing obesity than individuals who do not have these genotypes.
20856253 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20839491 Our data suggests an association between sIL-6R, perception of pain and reduced peak muscle performance post-exercise-induced muscle damage
20823887 Immunohistochemistry revealed that loss of tumour expression of sIL-6R was significantly inversely correlated with intense IL-6 expression in the cytoplasm of cancer cells
20811626 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20800603 Observational study of gene-disease association. (HuGE Navigator)
20727736 Observational study of gene-disease association. (HuGE Navigator)
20698883 Data indicate the IL6R is downregulated in human gastric adenocarcinoma cell line MGC803; IL6R appears to be the target gene for miR-23a (that is up-regulated in MGC803 cells and human gastric adenocarcinoma tissues).
20673868 Observational study of gene-disease association. (HuGE Navigator)
20661738 Findings show that the IL-6 receptor rs8192284 polymorphism is operative in patients with rheumatoid arthritis.
20661738 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20600579 Results indicate that ET monocytes are responsible for sIL-6R overproduction within mononuclear cells through synthesis upregulation.
20599261 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
20568250 Observational study of gene-disease association. (HuGE Navigator)
20551110 The anti-CCP status in patients with rheum-atoid arthritis determines the association between the IL6R rs8192284 polymorphism and disease activity.
20551110 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20503287 Observational study of gene-disease association. (HuGE Navigator)
20484876 Meta-analysis of gene-disease association. (HuGE Navigator)
20463041 Dietary alpha-linolenic acid intake is inversely associated with plasma sIL-6R concentrations in a study of male twins.
20453000 Observational study of gene-disease association. (HuGE Navigator)
20452482 First demonstration of an associationa between IL6R and spontaneous preterm labor with intact membranes in Hispanic women.
20452482 Observational study of gene-disease association. (HuGE Navigator)
20438838 sIL-6R was protected from proteolysis by interaction with IL-6 in cystic fibrosis derived bronchoalveolar fluid.
20423763 The gene expression of IL-6 and TNF-alpha is increased in active UC. Interleukin 6 is better marker of bowel inflammation because its expression correlates with histological activity
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
20197062 This study demonistrated that the -530T allele located in a putative regulatory region and the +48867C allele at the splice site may elevate the risk of SAD among the Han Chinese.
20197062 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20186139 These data, which are in accord with studies from white populations suggest the IL-6R SNP may play a role in the pathogenesis of the metabolic syndrom possibly through modulating IL-6 levels.
20159251 p-STAT3 levels are decreased in chronic rhinosinusitis with nasal polyps despite increased levels of IL-6 and sIL-6R and are associated with the absence of an IL-17 response
20157327 Observational study of gene-disease association. (HuGE Navigator)
20145925 Observational study of gene-disease association. (HuGE Navigator)
20140262 Observational study of gene-disease association. (HuGE Navigator)
20083667 Infiltrating effector T cells from patients with bacterial peritonitis lose IL-6 receptor expression either by recruitment of
20031577 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20026129 Data demonstrate that after ADAM17 mediated cleavage, the IL6R C-terminal fragment is cleaved by gamma-secretase at the plasma membrane.
20017315 D358A polymorphism of IL6R gene is significantly associated with type 2 diabetes in Chinese.
20017315 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
19966016 An IL-6- and sIL-6R-dependent downregulation of the tumour suppressor maspin.
19926672 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19914334 The genetic variants of IL-6 and IL-6R are not associated with schizophrenia.
19914334 Observational study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19877065 The infrapatellar fat pad cytokine profile typically found in osteoarthritis patients could play a role in paracrine inflammation via the local production of IL-6/sIL-6R and that such a profile might contribute to damage in adjacent cartilage.
19790045 Mechanical injury potentiates the catabolic effects of TNFalpha and IL-6/sIL-6R in causing proteoglycan degradation in human and bovine cartilage.
19773451 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19773279 Observational study of gene-disease association. (HuGE Navigator)
19733878 Observational study of gene-disease association. (HuGE Navigator)
19713205 Data suggest a role for genetically determined lower sIL-6R levels as a risk factor for rheumatoid arthritis but the findings of this study suggest a protective effect of IL6.
19692168 Observational study of gene-disease association. (HuGE Navigator)
19671870 The rs8192284 IL-6 receptor SNP revealed no prognostic value in neuroblastoma patients.
19665805 increased levels in the sera of women with recurrent spontaneous abortions
19633828 Data propose that dysregulation of membrane proteolysis by TACE/TIMP3 of TNF-alpha and IL-6R is an important factor for the development of skeletal muscle insulin resistance in obese type 2 diabetes patients by a novel autocrine/paracrine mechanism.
19625176 Observational study of gene-disease association. (HuGE Navigator)
19573080 Observational study of gene-disease association. (HuGE Navigator)
19567438 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19527514 Observational study of gene-disease association. (HuGE Navigator)
19505916 Observational study of gene-disease association. (HuGE Navigator)
19503017 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19495883 Observational study of gene-disease association. (HuGE Navigator)
19453261 Observational study of gene-disease association. (HuGE Navigator)
19422646 patients with CFS[chronic fatigue syndrome] do not have altered plasma levels of IL-6, sIL-6R or sgp130 either at rest or following exercise.
19420002 Report downregulation of cilia-localized Il-6R alpha by 17beta-estradiol in mouse and human fallopian tubes.
19406470 Observational study of gene-disease association. (HuGE Navigator)
19396608 In the sudden infant death syndrome cases, mean IL-6R intensity grade in the arcuate nucleus (major component of medullary 5-HT system) was significantly higher than in the control group
19336475 Observational study of gene-disease association. (HuGE Navigator)
19280716 Observational study of gene-disease association. (HuGE Navigator)
19277666 IL-6/sIL-6R complex showed angiogenic activity via the production of VEGF from synovial cells from rheumatoid arthritis patients, but TNF-alpha was anti-angiogenic.
19258923 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19170196 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19124510 Observational study of gene-disease association. (HuGE Navigator)
19088723 Cross talk of signals between EGFR and IL-6R through JAK2/STAT3 mediate epithelial-mesenchymal transition in ovarian carcinomas.
19026125 No significant association was found between +48892 IL-6R or +24013 IL-6R- polymorphisms and nationality or in Behcets disease or health controls.
19026125 Observational study of gene-disease association. (HuGE Navigator)
19019335 Observational study of gene-disease association. (HuGE Navigator)
18980999 sIL-6R levels <2.5 x 10(4) pg/mL were also associated with a significantly worse event-free survival
18971377 Results show that the designer fusion protein H-IL-6, consisting of IL-6 and its specific receptor IL-6R-alpha, but not IL-6 alone, mediates both neuro- as well as gliogenesis.
18853133 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
18852330 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18818748 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18784373 Serum IL-6 and sIL-6R markedly increased after tocilizumab administration in both RA and Castleman disease.
18781131 These data suggest the involvement of IL-6R in melanoma development.
18781131 Observational study of gene-disease association. (HuGE Navigator)
18676680 Observational study of gene-disease association. (HuGE Navigator)
18543249 Concluded that IL-6/sIL-6R enhances cathepsin B and L production via IL-6/sIL-6R-mediated Cav-1-JNK-AP-1 pathway in human gingival fibroblasts.
18538149 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18508242 the study suggest a small but significant contribution of the IL-6R polymorphism to susceptibility to schizophrenia in a Chinese population
18490707 Production of sIL-6R by autoreactive CD4 T cells may contribute to their role in the development of autoimmune disease by conferring IL-6-responsiveness to cells lacking IL-6R such as synoviocytes.
18464913 Observational study of gene-disease association. (HuGE Navigator)
18320358 Acute, incremental, fatiguing, submaximal exercise stress in sedentary middle-aged men results in an increase in sIL-6R.
18276608 IL-6 and IL6-R SNPs were analyzed for associations with preterm birth.
18276608 Observational study of gene-disease association. (HuGE Navigator)
18065760 Interleukin-6 (IL-6) and/or soluble IL-6 receptor down-regulation of human type II collagen gene expression in articular chondrocytes requires a decrease of Sp1.Sp3 ratio and of the binding activity of both factors to the COL2A1 promoter
17984249 Observational study of gene-disease association. (HuGE Navigator)
17984249 As a mediator of interleukin-6 action, the interleukin-6 receptor gene is involved in the determination of body mass index and bone mineral density.
17908769 We hypothesized that polymorphisms in inflammatory response genes contribute to the increased susceptibility to acute otitis media.The IL6-174 G/G genotype was overrepresented in children with acute otitis media when compared with controls
17898129 Observational study of gene-disease association. (HuGE Navigator)
17898129 IL6R genotypes were not significantly associated with the risk of type 2 diabetes.
17703412 Observational study of gene-disease association. (HuGE Navigator)
17671508 A common variant of the IL-6r gene results in major changes in IL-6r and IL-6 serum levels, but with no apparent effect on gp130 levels or on inflammatory status in the general population.
17652155 A higher gene expression of CRP, IL-6, and both IL-6 membrane receptors in subcutaneous samples of inflamed patients than in healthy controls.
17619842 The aim of the study is to define IL-6 target gene regulation in cultivated human detrusor smooth muscle cells.
17570254 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17519976 administration of IL-6 could activate receptor gp80/gp130 signaling pathways including downstream extracellular signal-regulated kinase 1/2 and STAT3 phosphorylation in EPCs.
17357077 using admixture mapping, we found a significant association of interleukin 6 soluble receptor (IL-6 SR) with European ancestry on chromosome 1 (LOD 4.59), in a region that includes the gene for this receptor (IL-6R)
17346257 Observational study of gene-disease association. (HuGE Navigator)
17313958 blockade of IL-6 receptor following trauma-hemorrhage appears to be a novel and effective adjunct for improving organ and cell function
17310346 Anti-IL-6R antibody abrogated the inhibited proliferation and increased invasion induced by IL-6.
17160948 Observational study of gene-disease association. (HuGE Navigator)
17151125 HIV-1 gp120 upregulates the expression of interleukin 6 receptor (IL6R) in human B cells
16973585 physical evidence of the stabilization of vIL-6-induced gp130 signaling complexes by gp80
16912152 The selective increase in sIL-6R implicates an enhanced trans-signaling capacity whereby sleep distinctly widens the profile of IL-6 actions, enabling an integrated influence on brain and peripheral organs
16899024 Observational study of gene-disease association. (HuGE Navigator)
16817825 Observational study of gene-disease association. (HuGE Navigator)
16794539 High pretransplant sIL-6R plasma levels are associated with an increased risk of acute tubular necrosis (ATN) and might contribute to the development of ATN early posttransplant
16731080 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16557588 Tax-mediated regulations of IL-6R and sIL-6R observed in HTLV-I-associated disorders may contribute to proliferation of HTLV-I-infected T cells through activation of inducible STAT3
16372246 CD30-L/CD30 and IL-6/IL-6R systems could play a major role in the pathogenesis of Graves'disease (GD), but the expression of CD30L/CD30 and IL-6/IL-6R in Hashimoto's thyroiditis (HT) suggests that Th2 mechanisms are involved in tissue damage.
16127269 Production of IL-6 and its soluble receptors by stimulated peripheral blood monocytes appears to be inversely correlated with serum cholesterol levels in hemodialysis patients.
16034137 Airway epithelial cell IL-6 and soluble IL-6 receptor alpha participate in inflammatory trans-signaling in response to bacterial pathogens.
15895091 A crystal structure of the ligand-binding domains of gp130 in complex with human interleukin-6 (IL-6) and its a-receptor (IL-6Ralpha).
15857508 HIV-1 gp120 upregulates the expression of interleukin 6 receptor (IL6R) in human B cells
15816827 co-expression of IL-6 and its specific receptor (IL-6Ralpha) in keloid fibroblasts that points to the existence of an IL-6 autocrine loop in these cells.
15641051 IL-1beta- and TNFalpha-mediated induction of IL-6R shedding in osteoblast-like cells is at least partly dependent on tumor necrosis factor alpha-converting enzyme activation.
15625895 Serum sIL-6R levels is a predictive factor for responsiveness to chemotherapy and an indicator of disease activity.
15579373 the soluble form of IL-6 receptor is expressed on normal human platelets
15562008 Observational study of genotype prevalence and gene-disease association. (HuGE Navigator)
15562008 Variants are associated with Type II diabetes and diabetic nephropathy.
15561970 Observational study of gene-disease association. (HuGE Navigator)
15561970 Asp358Ala polymorphism of the IL6R associates with type 2 diabetes in Danish whites.
15456942 Data describe the relationship between interleukin-6 and interleukin-6 soluble receptor in stroke patients.
15306846 Observational study of gene-disease association. (HuGE Navigator)
15297310 Detailed pathway analysis revealed that BM stromal cells stimulate STAT3 via the IL-6R, and MEK1/ERK1 pathways, via IL-6R-independent mechanisms
15284182 Butyrate acts by inhibiting IL-6-induced interleukin 6 receptor expression in colorectal carcinoma cells.
15213442 NMR structure of the carboxyl terminal domain of the cytokine binding module of the interleukin-6 receptor
15166129 IL-6 and sIL-6R may contribute to the pathogenesis of endometriosis-associated infertility
15100312 Study using normal peritoneal mesothelial cells and inflammatory exudates reveals the comparable ability of two types of soluble IL-6 receptor isoforms to regulate neutrophil recruitment.
15063602 Serum pro-inflammatory cytokine IL-6 or TNF-alpha concentrations were neither increased in subjects with impaired glucose tolerance nor closely correlated with the components of the metabolic syndrome.
15041717 In prostatectomy patients, preoperative plasma levels of TGF-beta(1) and IL-6sR are associated with metastases to regional lymph nodes and disease progression.
14592826 IL-6R alpha and IGF-I receptors exist on the plasma membrane in close proximity, facilitating the efficient assembly of 2 receptors in response to IL-6 in myeloma
12917504 Observational study of gene-disease association. (HuGE Navigator)
12857602 IL-15 alone, similarly to IL-18, has no significant ability for regulation of both soluble IL-6 receptors, sIL-6R and sgp130, released by human neutrophils.
12832423 cholesterol depletion triggers shedding of the human interleukin-6 receptor by ADAM10 and ADAM17
12829785 a structural model, derived from 3.65 A resolution crystallographic data of the complex between IL-6, the extracellular binding domains of IL-6R, and the extracellular activation and binding domains of gp130 is presented
12789531 IL-6 derived from blood during breakdown of blood-retinal barrier and produced by retinal pigment epithelial(RPE) cells and hematogenous soluble interleukin-6 receptor cause RPE proliferation.
12748876 might also be valuable biochemical marker in the evaluation of oocyte maturation
12748171 type 1 tumor necrosis factor receptor shedding aminopeptidase regulator(ARTS-1) promotes shedding of two cytokine receptor superfamilies, type I cytokine receptor superfamily (interleukin-6Ralpha) and tumor necrosis factor receptor superfamily (TNFR1)
12643274 IL-6 receptor binds to CTNF and is involved in neuroprotection
12633863 identification of existence as a preformed dimer in plasma membrane
12574959 IL-6r and TNF-alpha increase in parallel to VEGF and FGF-2 with increasing stage of multiple myeloma.
12553555 only in a subset of both benign and malignant thyroid nodules the interleukin-6/interleukin-6 receptor signal could be induced by the CD30 ligand/CD30
12553038 Induction of VEGF seems to be regulated by the extent of the IL-6 receptor expression on pancreatic cancer cells.
12472176 There is no significant effect of IL-18 on the release of both soluble receptors of IL-6.
12461182 X-ray structure (2.4 A) of the IL-6R ectodomains shows the N-terminal strand of the D(1)domain is disulfide-bonded to domain D(2). The head-to-tail packing of 2 closely associated IL-6R molecules may be the configuration of the physiological IL-6R dimer.
12445803 soluble proteins of tumour necrosis factor-alpha (TNF-alpha), interleukin-6 (IL-6) and IL-6 receptor subunit gp80 (sIL-6R gp80), as markers of multiple sclerosis
12419823 results show for the first time that interleukin-6 (IL), in the presence of its soluble receptor (sIL-6R), induces activation of JAK1, JAK2, and STAT1/STAT3 proteins in bovine articular chondrocytes
12414855 combined measurements of serum interleukin-6 soluble receptor and interleukin-6 may be helpful in identifying patients with untreated hyperparathyroidism who are more likely to experience bone loss at the total femur
12372336 Human bone marrow-derived mesenchymal cells do not differentiate into the osteogenic lineage until Gp130 is activated by soluble interleukin-6 receptors and interleukin-6.
12079407 Proteolysis of interleukin-6 receptor (IL-6R) by Porphyromonas gingivalis cysteine proteinases (gingipains) inhibits interleukin-6-mediated cell activation.
12008038 the soluble interleukin-6 receptor isoform induces major changes in gene expression profile of human hepatoma cells
12002769 Serum sIL-6R levels reflect proliferative kinetics of the progenitors after stimulation by chemotherapy plus granulocyte colony-stimulating factor.
11884403 Shedding of the interleukin-6 (IL-6) receptor (gp80) determines the ability of IL-6 to induce gp130 phosphorylation in human osteoblasts.
8450224 HIV-1 gp120 upregulates the expression of interleukin 6 receptor (IL6R) in human B cells

AA Sequence

MLAVGCALLAALLAAPGAALAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSH      1 - 70
PSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTP     71 - 140
SLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQG    141 - 210
CGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIH    211 - 280
DAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSAN    281 - 350
ATSLPVQDSSSVPLPTFLVAGGSLAFGTLLCIAIVLRFKKTWKLRALKEGKTSMHPPYSLGQLVPERPRP    351 - 420
TPVLVPLISPPVSPSSLGSDNTSSHNRPDARDPRSPYDISNTDYFFPR                          421 - 468
//

Text Mined References (315)

PMID Year Title
26997259 2016 The IL6R gene polymorphisms are associated with sIL-6R, IgE and lung function in Chinese patients with asthma.
26782593 2015 Association of phosphodiesterase 4D gene and interleukin-6 receptor gene polymorphisms with ischemic stroke in a Chinese hypertensive population.
26714766 2015 Polymorphisms in the IL-6 and IL-6R receptor genes as new diagnostic biomarkers of acute appendicitis: a study on two candidate genes in pediatric patients with acute appendicitis.
26699882 2015 IL-6 Transsignaling in Patients with Chronic Spontaneous Urticaria.
26563755 2015 Rs12976445 Polymorphism is Associated with Risk of Diabetic Nephropathy Through Modulating Expression of MicroRNA-125 and Interleukin-6R.
26424054 2015 MiR-125a-5p Decreases the Sensitivity of Treg cells Toward IL-6-Mediated Conversion by Inhibiting IL-6R and STAT3 Expression.
26359498 2015 Shedding of Endogenous Interleukin-6 Receptor (IL-6R) Is Governed by A Disintegrin and Metalloproteinase (ADAM) Proteases while a Full-length IL-6R Isoform Localizes to Circulating Microvesicles.
26329582 2015 The adaptor protein TRAF3 inhibits interleukin-6 receptor signaling in B cells to limit plasma cell development.
26205065 2016 Assessment of angiogenesis modulators in pregnant women with pre-eclampsia: a case-control study.
26200663 2015 Obesity Is a Positive Modulator of IL-6R and IL-6 Expression in the Subcutaneous Adipose Tissue: Significance for Metabolic Inflammation.
26198920 2015 Family-based association study of interleukin 6 (IL6) and its receptor (IL6R) functional polymorphisms in schizophrenia in the Polish population.
26086344 2015 Genetic and environmental determinants of population variation in interleukin-6, its soluble receptor and C-reactive protein: insights from identical and fraternal twins.
26080005 2015 Biological effects of interleukin-6: Clinical applications in autoimmune diseases and cancers.
25973020 2015 MiR-34a inhibits oral cancer progression partially by repression of interleukin-6-receptor.
25930193 2015 Allergen-induced IL-6 trans-signaling activates ?? T cells to promote type 2 and type 17 airway inflammation.
25910182 2015 Circulating levels of interleukin 6 soluble receptor and its natural antagonist, sgp130, and the risk of myocardial infarction.
25846075 2015 Secreted Frizzled-related protein 3 (sFRP3)-mediated suppression of interleukin-6 receptor release by A disintegrin and metalloprotease 17 (ADAM17) is abrogated in the osteoarthritis-associated rare double variant of sFRP3.
25813875 2015 Interleukin and growth factor gene variants and risk of carpal tunnel syndrome.
25792278 2015 Soluble interleukin 6 receptor levels are associated with reduced myocardial reperfusion after percutaneous coronary intervention for acute myocardial infarction.
25781951 2015 Analysis of the role of interleukin 6 receptor haplotypes in the regulation of circulating levels of inflammatory biomarkers and risk of coronary heart disease.
25658637 2015 Interleukin 6 receptor is an independent prognostic factor and a potential therapeutic target of ovarian cancer.
25524550 2015 Association of a polymorphism of the interleukin 6 receptor gene with chronic kidney disease in Japanese individuals.
25491772 2014 Increased expression of the Th17-IL-6R/pSTAT3/BATF/Ror?T-axis in the tumoural region of adenocarcinoma as compared to squamous cell carcinoma of the lung.
25345743 2014 Establishment of a novel cell-based assay for screening small molecule antagonists of human interleukin-6 receptor.
25340798 2014 Genome-wide association study of CSF levels of 59 alzheimer's disease candidate proteins: significant associations with proteins involved in amyloid processing and inflammation.
25335739 2014 Prognostic value of circulating inflammatory factors in non-small cell lung cancer: a systematic review and meta-analysis.
25245339 2015 Interleukin-6, soluble interleukin-6 receptor/interleukin-6 complex and insulin resistance in obese children and adolescents.
25183374 2014 Increased levels of soluble interleukin-6 receptor and CCL3 in COPD sputum.
25176527 2015 Soluble interleukin-6 receptor is elevated during influenza A virus infection and mediates the IL-6 and IL-32 inflammatory cytokine burst.
25058889 2015 HMGB1-Mediated Early Loss of Transplanted Islets Is Prevented by Anti-IL-6R Antibody in Mice.
25052265 2014 [Association between genetic polymorphisms of interleukin 6 (IL6), IL6R and IL18 with metabolic syndrome in obese Chilean children].
25041016 2014 An interleukin-6 receptor polymorphism is associated with opisthorchiasis-linked cholangiocarcinoma risk in Thailand.
24993179 2014 Interleukin-6, but not the interleukin-6 receptor plays a role in recovery from dextran sodium sulfate-induced colitis.
24986424 2014 Interleukin-6 and its receptors: a highly regulated and dynamic system.
24978393 2014 Interleukin-6-receptor polymorphisms rs12083537, rs2228145, and rs4329505 as predictors of response to tocilizumab in rheumatoid arthritis.
24971337 2014 An association study between genetic polymorphism in the interleukin-6 receptor gene and coronary heart disease.
24940886 2014 A variant of IL6R is associated with the recurrence of atrial fibrillation after catheter ablation in a Chinese Han population.
24939178 2014 Regulation of SOD2 and ?-arrestin1 by interleukin-6 contributes to the increase of IGF-1R expression in docetaxel resistant prostate cancer cells.
24898204 Familial Kaposi's Sarcoma in HHV8 infected subjects presenting the G-174C allele of the IL-6 promoter: a possible role for EBV?
24886605 2014 Genetic modulation of the interleukin 6 (IL-6) system in patients with advanced gastric cancer: a background for an alternative target therapy.
24878322 2014 The interleukin-6 receptor Asp358Ala single nucleotide polymorphism rs2228145 confers increased proteolytic conversion rates by ADAM proteases.
24806843 2014 Interleukin-6-induced epithelial-mesenchymal transition through signal transducer and activator of transcription 3 in human cervical carcinoma.
24802752 2014 The amino acid exchange R28E in ciliary neurotrophic factor (CNTF) abrogates interleukin-6 receptor-dependent but retains CNTF receptor-dependent signaling via glycoprotein 130 (gp130)/leukemia inhibitory factor receptor (LIFR).
24791950 2014 The contribution of the functional IL6R polymorphism rs2228145, eQTLs and other genome-wide SNPs to the heritability of plasma sIL-6R levels.
24790088 2014 A disintegrin and metalloprotease 17 dynamic interaction sequence, the sweet tooth for the human interleukin 6 receptor.
24772425 2014 A 3'UTR polymorphism of IL-6R is associated with Chinese pediatric tuberculosis.
24717336 2014 Interleukin-6 receptor Asp358Ala gene polymorphism is associated with plasma C-reactive protein levels and severity of aortic valve stenosis.
24710939 2014 Influences of IL-6R antibody on PMMA bone cement-mediated expression of OPG and RANKL in synovial fibroblasts.
24699044 2014 Interleukin-6 receptor rs7529229 T/C polymorphism is associated with left main coronary artery disease phenotype in a Chinese population.
24668548 2014 Susceptibility to hepatocellular carcinoma in the Chinese population--associations with interleukin-6 receptor polymorphism.
24642471 2014 IL-6R/STAT3/miR-34a feedback loop promotes EMT-mediated colorectal cancer invasion and metastasis.
24554482 2014 Genome-wide association study of peripheral neuropathy with D-drug-containing regimens in AIDS Clinical Trials Group protocol 384.
24498998 2013 No evidence of association between functional polymorphisms located within IL6R and IL6ST genes and Henoch-Schönlein purpura.
24445140 2014 MicroRNA-451 suppresses tumor cell growth by down-regulating IL6R gene expression.
24429361 2014 Hepatitis C virus-induced changes in microRNA 107 (miRNA-107) and miRNA-449a modulate CCL2 by targeting the interleukin-6 receptor complex in hepatitis.
24390342 2014 Genetics of rheumatoid arthritis contributes to biology and drug discovery.
24346288 2014 Interleukin-6 released by colon cancer-associated fibroblasts is critical for tumour angiogenesis: anti-interleukin-6 receptor antibody suppressed angiogenesis and inhibited tumour-stroma interaction.
24285563 2014 Soluble interleukin-6 receptor level reflecting the illness activity in bipolar disorder.
24285489 2014 Investigation of an interleukin-6 receptor gene polymorphism (rs2228145) as a predictor of cardiovascular mortality in inflammatory polyarthritis: results from the Norfolk Arthritis Register.
24165468 2013 Soluble TNF and IL-6 receptors: indicators of vascular health in women without cardiovascular disease.
24152848 Novel path to IL-6 trans-signaling through thrombin-induced soluble IL-6 receptor release by platelets.
24140252 2013 Exercise affects symptom severity but not biological measures in depression and somatization - results on IL-6, neopterin, tryptophan, kynurenine and 5-HIAA.
24118365 2014 Do baseline Cereblon gene expression and IL-6 receptor expression determine the response to thalidomide-dexamethasone treatment in multiple myeloma patients?
24114630 2013 An interleukin-6 gene promoter polymorphism is associated with polycystic ovary syndrome in South Indian women.
24032723 2013 Interleukin-6 level and gene polymorphism in spontaneous miscarriage.
23969696 2013 Multiethnic meta-analysis of genome-wide association studies in >100 000 subjects identifies 23 fibrinogen-associated Loci but no strong evidence of a causal association between circulating fibrinogen and cardiovascular disease.
23945879 2013 A new regulatory variant in the interleukin-6 receptor gene associates with asthma risk.
23935104 2013 The transcription factor Twist1 limits T helper 17 and T follicular helper cell development by repressing the gene encoding the interleukin-6 receptor ? chain.
23926072 Construction of unnatural heterodimeric receptors based on IL-2 and IL-6 receptor subunits.
23902164 2013 Soluble interleukin-6 receptor is a prognostic marker for relapse-free survival in estrogen receptor-positive breast cancer.
23782174 2013 Alterations of IL-6, IL-6R and gp130 in early and late onset severe preeclampsia.
23771909 2013 Upregulation of skeletal muscle inflammatory genes links inflammation with insulin resistance in women with the metabolic syndrome.
23677452 2013 Receptors to interleukin-6 and adhesion molecules on circulating monocyte subsets in acute myocardial infarction.
23658720 2013 Enhanced IL-6/IL-6R signaling promotes growth and malignant properties in EBV-infected premalignant and cancerous nasopharyngeal epithelial cells.
23648090 2013 Soluble interleukin-6 receptor is a serum biomarker for the response of esophageal carcinoma to neoadjuvant chemoradiotherapy.
23594084 2013 The interleukin 6 receptor alpha gene polymorphisms are associated with clinical manifestations of systemic lupus erythematosus in Koreans.
23593036 2013 Functional IL6R 358Ala allele impairs classical IL-6 receptor signaling and influences risk of diverse inflammatory diseases.
23582716 2013 IL-6 and its receptors in coronary artery disease and acute myocardial infarction.
23582566 2013 A functional IL-6 receptor (IL6R) variant is a risk factor for persistent atopic dermatitis.
23564454 2013 Minimal interleukin 6 (IL-6) receptor stalk composition for IL-6 receptor shedding and IL-6 classic signaling.
23479153 2013 Influence of the 48867A>C (Asp358Ala) IL6R polymorphism on response to a lifestyle modification intervention in individuals with metabolic syndrome.
23433353 2014 The association of IL-6 and IL-6R gene polymorphisms with chronic periodontitis in a Chinese population.
23428306 2013 Components of the interleukin-6 transsignalling system are associated with the metabolic syndrome, endothelial dysfunction and arterial stiffness.
23375120 2013 Alternative splicing and proteolytic rupture contribute to the generation of soluble IL-6 receptors (sIL-6R) in rheumatoid arthritis.
23242610 2013 The relationship between soluble receptor of interleukin-6 with angiogenic cytokines and proliferation markers in multiple myeloma.
23199226 2013 Circulating interleukin 6 and soluble forms of its receptors in relation to resting energy expenditure in women with anorexia nervosa.
23094986 2012 Interleukin-6 receptor gene 48892 A/C polymorphism is associated with metabolic syndrome in female Taiwanese adolescents.
23078005 2013 Comparative analysis of IL6 and IL6 receptor gene polymorphisms in mastocytosis.
23073775 2013 Association of two variants in the interleukin-6 receptor gene and premature coronary heart disease in a Chinese Han population.
22984080 2012 Receptor cross-talk spatially restricts p-ERK during TLR4 stimulation of autoreactive B cells.
22911828 2012 Soluble interleukin-6 receptor induces motor stereotypies and co-localizes with gp130 in regions linked to cortico-striato-thalamo-cortical circuits.
22761857 2012 Satellite cells derived from obese humans with type 2 diabetes and differentiated into myocytes in vitro exhibit abnormal response to IL-6.
22742541 2012 No evidence of association between functional polymorphisms located within IL6R and IL6ST genes and systemic sclerosis.
22642608 2012 Polymorphisms in the interleukin-6 receptor gene (Asp358Ala) and body mass index in Chilean women with type 1 diabetes.
22554704 2012 The IL6R variation Asp(358)Ala is a potential modifier of lung function in subjects with asthma.
22552503 2012 Blockade of interleukin-6 receptor suppresses the proliferation of H460 lung cancer stem cells.
22449275 2012 Interleukin-6 polymorphism and bronchopulmonary dysplasia risk in very low-birthweight infants.
22421339 2012 Interleukin-6 receptor pathways in coronary heart disease: a collaborative meta-analysis of 82 studies.
22319020 2012 A genome-wide association study for coronary artery disease identifies a novel susceptibility locus in the major histocompatibility complex.
22295972 2012 Interleukin-6 receptor ? is co-localised with melanin-concentrating hormone in human and mouse hypothalamus.
22209080 2012 Elevated urinary sVCAM-1, IL6, sIL6R and TNFR1 concentrations indicate acute kidney transplant rejection in the first 2 weeks after transplantation.
22133618 2012 Sleep disturbances and interleukin 6 receptor inhibition in rheumatoid arthritis.
22128229 2011 Proinflammatory gene polymorphisms are potentially associated with Korean non-Sjogren dry eye patients.
22079540 2012 Analysis of IL-6, IL-10 and IL-17 genetic polymorphisms as risk factors for sepsis development in burned patients.
22072558 2012 An intermediate-risk multiple myeloma subgroup is defined by sIL-6r: levels synergistically increase with incidence of SNP rs2228145 and 1q21 amplification.
21989726 2011 Role of the IL-6 classic- and trans-signaling pathways in corneal sterile inflammation and wound healing.
21981268 2011 Lack of association of IL6R rs2228145 and IL6ST/gp130 rs2228044 gene polymorphisms with cardiovascular disease in patients with rheumatoid arthritis.
21968316 2011 A pilot study of endothelial dysfunction and aortic stiffness after interleukin-6 receptor inhibition in rheumatoid arthritis.
21907864 2011 Identification of IL6R and chromosome 11q13.5 as risk loci for asthma.
21879314 2012 Association of cognitive performance with interleukin-6 receptor Asp358Ala polymorphism in healthy adults.
21851175 2011 Genetic variations in the interleukin-6 and interleukin-8 genes and the interleukin-6 receptor gene in delirium.
21846873 2011 Large-scale candidate gene analysis in whites and African Americans identifies IL6R polymorphism in relation to atrial fibrillation: the National Heart, Lung, and Blood Institute's Candidate Gene Association Resource (CARe) project.
21835044 2011 Association between interleukin-6 receptor gene variations and atherosclerotic lipid profiles among young adolescents in Taiwan.
21813064 Anti-IL-6 receptor antibody (tocilizumab): a B cell targeting therapy.
21748280 2012 Association between polymorphism in the promoter region of Interleukin 6 (-174 G/C) and risk of Alzheimer's disease: a meta-analysis.
21700295 2011 Association of plasma IL-6 and soluble IL-6 receptor levels with the Asp358Ala polymorphism of the IL-6 receptor gene in schizophrenic patients.
21515913 2011 Mesothelin overexpression promotes autocrine IL-6/sIL-6R trans-signaling to stimulate pancreatic cancer cell proliferation.
21496483 2011 Fatigued breast cancer survivors and gene polymorphisms in the inflammatory pathway.
21490132 2011 Celecoxib inhibits interleukin-6/interleukin-6 receptor-induced JAK2/STAT3 phosphorylation in human hepatocellular carcinoma cells.
21401300 2011 Plasma hepcidin correlates positively with interleukin-6 in patients undergoing pulmonary endarterectomy.
21300955 2011 Meta-analysis of genome-wide association studies in >80 000 subjects identifies multiple loci for C-reactive protein levels.
21295508 2011 Roles of circulating soluble interleukin (IL)-6 receptor and IL-6 receptor expression on CD4+ T cells in patients with chronic hepatitis B.
21282511 2011 IL-6 trans-signaling system in intra-amniotic inflammation, preterm birth, and preterm premature rupture of the membranes.
21255427 2011 Athletic humans and horses: comparative analysis of interleukin-6 (IL-6) and IL-6 receptor (IL-6R) expression in peripheral blood mononuclear cells in trained and untrained subjects at rest.
21229891 Transcriptional regulation of interleukin 6 and its receptor in colon cancer cells by phytic acid.
21220034 2011 Increased copy number of the interleukin-6 receptor gene is associated with adverse survival in multiple myeloma patients treated with autologous stem cell transplantation.
21196890 2011 Investigation of interleukin-1 alpha and interleukin-6 expression and interleukin-1 alpha gene polymorphism in keratocystic odontogenic tumors and ameloblastomas.
21173340 2011 Elevated maternal soluble Gp130 and IL-6 levels and reduced Gp130 and SOCS-3 expressions in women complicated with preeclampsia.
21159831 2011 Radiographic bone damage in chronic gout is negatively associated with the inflammatory cytokines soluble interleukin 6 receptor and osteoprotegerin.
20974296 2012 The CC homozygosis of the -174G>C IL-6 polymorphism predicts a lower efficacy of rituximab therapy in rheumatoid arthritis.
20951753 2011 Association of IL-6 and IL-6R gene polymorphisms with susceptibility to respiratory tract infections in young Finnish men.
20856253 2011 Combined effect of C-reactive protein gene SNP +2147 A/G and interleukin-6 receptor gene SNP rs2229238 C/T on anthropometric characteristics among school children in Taiwan.
20839491 2010 The effect of exercise on plasma soluble IL-6 receptor concentration: a dichotomous response.
20823887 2010 Loss of tumoral expression of soluble IL-6 receptor is associated with disease progression in colorectal cancer.
20811626 2010 Genetic variants in inflammation-related genes are associated with radiation-induced toxicity following treatment for non-small cell lung cancer.
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
20727736 2011 C-reactive protein-associated genetic variants and cancer risk: findings from FINRISK 1992, FINRISK 1997 and Health 2000 studies.
20698883 2010 MicroRNA-23a promotes the growth of gastric adenocarcinoma cell line MGC803 and downregulates interleukin-6 receptor.
20673868 2010 A genetic association study of maternal and fetal candidate genes that predispose to preterm prelabor rupture of membranes (PROM).
20661738 2011 Plasma soluble IL-6 receptor concentration in rheumatoid arthritis: associations with the rs8192284 IL6R polymorphism and with disease activity.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20600579 2010 Abnormal regulation of soluble and anchored IL-6 receptor in monocytes from patients with essential thrombocythemia.
20599261 2010 Gene-gene interaction in regulatory T-cell function in atopy and asthma development in childhood.
20568250 2010 Common single nucleotide polymorphisms in immunoregulatory genes and multiple myeloma risk among women in Connecticut.
20551110 2010 Influence of IL6R rs8192284 polymorphism status in disease activity in rheumatoid arthritis.
20503287 2010 Interleukin-9 polymorphism in infants with respiratory syncytial virus infection: an opposite effect in boys and girls.
20484876 2010 Synopsis of preterm birth genetic association studies: the preterm birth genetics knowledge base (PTBGene).
20463041 2010 High habitual dietary alpha-linolenic acid intake is associated with decreased plasma soluble interleukin-6 receptor concentrations in male twins.
20453000 2010 A Large-scale genetic association study of esophageal adenocarcinoma risk.
20452482 2010 Identification of fetal and maternal single nucleotide polymorphisms in candidate genes that predispose to spontaneous preterm labor with intact membranes.
20438838 Inactivation of IL-6 and soluble IL-6 receptor by neutrophil derived serine proteases in cystic fibrosis.
20423763 [IL-6 and TNF-? gene expression in the rectal mucosal of patients with chronic idiopathic ulcerative colitis and controls].
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20197062 2010 Interleukin-6 receptor gene polymorphisms were associated with sporadic Alzheimer's disease in Chinese Han.
20186139 2010 Interleukin-6 receptor gene polymorphism modulates interleukin-6 levels and the metabolic syndrome: GBCS-CVD.
20159251 2010 Evidence for altered activity of the IL-6 pathway in chronic rhinosinusitis with nasal polyps.
20157327 2010 A variant near the interleukin-6 gene is associated with fat mass in Caucasian men.
20145925 2010 C-reactive protein -717C>T genetic polymorphism associates with esophagectomy-induced stress hyperglycemia.
20140262 2010 Maternal and fetal genetic associations of PTGER3 and PON1 with preterm birth.
20083667 2010 Loss of CD4+ T cell IL-6R expression during inflammation underlines a role for IL-6 trans signaling in the local maintenance of Th17 cells.
20031577 2009 Novel loci, including those related to Crohn disease, psoriasis, and inflammation, identified in a genome-wide association study of fibrinogen in 17 686 women: the Women's Genome Health Study.
20026129 2010 ADAM17-mediated shedding of the IL6R induces cleavage of the membrane stub by gamma-secretase.
20017315 2009 [Association of the D358A polymorphism of IL6R gene with type 2 diabetes in Hubei Han Chinese].
19966016 2010 Interleukin-6 trans-signalling differentially regulates proliferation, migration, adhesion and maspin expression in human prostate cancer cells.
19926672 2010 Genotype at the sIL-6R A358C polymorphism does not influence response to anti-TNF therapy in patients with rheumatoid arthritis.
19914334 2010 Genetic variants of IL-6 and its receptor are not associated with schizophrenia in Taiwan.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19877065 2009 The infrapatellar fat pad in knee osteoarthritis: an important source of interleukin-6 and its soluble receptor.
19790045 2009 Mechanical injury potentiates proteoglycan catabolism induced by interleukin-6 with soluble interleukin-6 receptor and tumor necrosis factor alpha in immature bovine and adult human articular cartilage.
19773451 2009 Role of inflammation gene polymorphisms on pain severity in lung cancer patients.
19773279 2009 Association between genetic variants in VEGF, ERCC3 and occupational benzene haematotoxicity.
19733878 2009 Interferon-gamma 874A>T genetic polymorphism is associated with infectious complications following surgery in patients with thoracic esophageal cancer.
19713205 2010 A gain of function polymorphism in the interleukin 6 receptor influences RA susceptibility.
19692168 2010 Genetic susceptibility to distinct bladder cancer subphenotypes.
19671870 2009 Prognostic significance of interleukin-6 single nucleotide polymorphism genotypes in neuroblastoma: rs1800795 (promoter) and rs8192284 (receptor).
19665805 2009 IL-6 trans-signaling and the frequency of CD4+FOXP3+ cells in women with reproductive failure.
19633828 2009 Impaired regulation of the TNF-alpha converting enzyme/tissue inhibitor of metalloproteinase 3 proteolytic system in skeletal muscle of obese type 2 diabetic patients: a new mechanism of insulin resistance in humans.
19625176 2009 PTEN identified as important risk factor of chronic obstructive pulmonary disease.
19573080 2009 Common genetic variants in candidate genes and risk of familial lymphoid malignancies.
19567438 2009 Genetic Loci associated with C-reactive protein levels and risk of coronary heart disease.
19527514 2009 Racial disparity in pathophysiologic pathways of preterm birth based on genetic variants.
19505916 2009 Cytokine and cytokine receptor single-nucleotide polymorphisms predict risk for non-small cell lung cancer among women.
19503017 2009 Genetic ancestry modifies pharmacogenetic gene-gene interaction for asthma.
19495883 2009 CRP genetic polymorphism is associated with lymph node metastasis in thoracic esophageal squamous cell cancer.
19453261 2009 High-density association study of 383 candidate genes for volumetric BMD at the femoral neck and lumbar spine among older men.
19422646 2010 Plasma IL-6, its soluble receptors and F2-isoprostanes at rest and during exercise in chronic fatigue syndrome.
19420002 2009 Downregulation of cilia-localized Il-6R alpha by 17beta-estradiol in mouse and human fallopian tubes.
19406470 2009 Comparative analysis of IL6 promoter and receptor polymorphisms in myelodysplasia and multiple myeloma.
19396608 2009 Interleukin-6 and the serotonergic system of the medulla oblongata in the sudden infant death syndrome.
19336475 2009 Integrated associations of genotypes with multiple blood biomarkers linked to coronary heart disease risk.
19280716 2009 The IL6-174G/C polymorphism is associated with celiac disease susceptibility in girls.
19277666 2009 IL-6/sIL-6R trans-signalling, but not TNF-alpha induced angiogenesis in a HUVEC and synovial cell co-culture system.
19258923 2009 Genetic susceptibility to respiratory syncytial virus bronchiolitis in preterm children is associated with airway remodeling genes and innate immune genes.
19170196 2009 Polymorphisms in innate immunity genes and lung cancer risk in Xuanwei, China.
19124510 2009 Insulin-like growth factor-1- and interleukin-6-related gene variation and risk of multiple myeloma.
19088723 2009 Cross talk of signals between EGFR and IL-6R through JAK2/STAT3 mediate epithelial-mesenchymal transition in ovarian carcinomas.
19026125 IL-6 receptor, IL-8 receptor and TNF-alpha238 (G/A) polymorphisms are not associated with Behçet's disease in patients of German or Turkish origin.
19019335 2009 Spontaneous preterm birth in African Americans is associated with infection and inflammatory response gene variants.
18980999 2008 Interleukin-6 and soluble interleukin-6 receptor levels as markers of disease extent and prognosis in neuroblastoma.
18971377 2009 Interleukin-6 and neural stem cells: more than gliogenesis.
18853133 2008 Gene variants influencing measures of inflammation or predisposing to autoimmune and inflammatory diseases are not associated with the risk of type 2 diabetes.
18852330 2009 Interleukin-6 receptor gene, plasma C-reactive protein, and diabetes risk in women.
18818748 2008 Preterm birth in Caucasians is associated with coagulation and inflammation pathway gene variants.
18784373 2008 Mechanisms and pathologic significances in increase in serum interleukin-6 (IL-6) and soluble IL-6 receptor after administration of an anti-IL-6 receptor antibody, tocilizumab, in patients with rheumatoid arthritis and Castleman disease.
18781131 2008 Interleukin and interleukin receptor gene polymorphisms and susceptibility to melanoma.
18775332 2008 Structural organization of a full-length gp130/LIF-R cytokine receptor transmembrane complex.
18719127 2008 Interleukin-6 regulates pancreatic alpha-cell mass expansion.
18676680 2008 Pathway-based evaluation of 380 candidate genes and lung cancer susceptibility suggests the importance of the cell cycle pathway.
18543249 2008 IL-6/sIL-6R enhances cathepsin B and L production via caveolin-1-mediated JNK-AP-1 pathway in human gingival fibroblasts.
18538149 2008 Racial disparity in maternal-fetal genetic epistasis in spontaneous preterm birth.
18508242 2008 Association between interleukin-6 receptor polymorphism and patients with schizophrenia.
18490707 2008 Cutting edge: soluble IL-6R is produced by IL-6R ectodomain shedding in activated CD4 T cells.
18464913 2008 A genome-wide association study identifies protein quantitative trait loci (pQTLs).
18439548 2008 Loci related to metabolic-syndrome pathways including LEPR,HNF1A, IL6R, and GCKR associate with plasma C-reactive protein: the Women's Genome Health Study.
18320358 2008 Response of plasma IL-6 and its soluble receptors during submaximal exercise to fatigue in sedentary middle-aged men.
18276608 2008 Interleukin-6 (IL-6) and receptor (IL6-R) gene haplotypes associate with amniotic fluid protein concentrations in preterm birth.
18065760 2008 Interleukin-6 (IL-6) and/or soluble IL-6 receptor down-regulation of human type II collagen gene expression in articular chondrocytes requires a decrease of Sp1.Sp3 ratio and of the binding activity of both factors to the COL2A1 promoter.
17984249 2007 Polymorphisms in the interleukin-6 receptor gene are associated with bone mineral density and body mass index in Spanish postmenopausal women.
17908769 2007 Genetic polymorphisms in immunoresponse genes TNFA, IL6, IL10, and TLR4 are associated with recurrent acute otitis media.
17903307 2007 Framingham Heart Study genome-wide association: results for pulmonary function measures.
17898129 2007 Interleukin-6 receptor gene variations, plasma interleukin-6 levels, and type 2 diabetes in U.S. Women.
17703412 2007 Genetic susceptibility to respiratory syncytial virus bronchiolitis is predominantly associated with innate immune genes.
17671508 2007 A common variant of the interleukin 6 receptor (IL-6r) gene increases IL-6r and IL-6 levels, without other inflammatory effects.
17652155 2007 Inflammation may modulate IL-6 and C-reactive protein gene expression in the adipose tissue: the role of IL-6 cell membrane receptor.
17619842 2007 [Lipopolysaccharide-mediated regulation of interleukin-6 in cultured human detrusor smooth muscle cells].
17570254 2007 The interaction between the interleukin 6 receptor gene genotype and dietary energy intake on abdominal obesity in Japanese men.
17519976 2008 Interleukin-6 stimulates circulating blood-derived endothelial progenitor cell angiogenesis in vitro.
17357077 2007 Admixture mapping of an allele affecting interleukin 6 soluble receptor and interleukin 6 levels.
17346257 2007 Ethnic differences in interleukin 6 (IL-6) and IL6 receptor genes in spontaneous preterm birth and effects on amniotic fluid protein levels.
17313958 2007 Anti-rat soluble IL-6 receptor antibody down-regulates cardiac IL-6 and improves cardiac function following trauma-hemorrhage.
17310346 2007 Interleukin-6 directly influences proliferation and invasion potential of head and neck cancer cells.
17160948 2006 [Association study of single nucleotide polymorphism of interleukin 6 receptor gene and type 2 diabetes in Chinese Han population].
16973585 2006 Structural requirements for gp80 independence of human herpesvirus 8 interleukin-6 (vIL-6) and evidence for gp80 stabilization of gp130 signaling complexes induced by vIL-6.
16912152 2006 Sleep enhances IL-6 trans-signaling in humans.
16899024 2006 Interleukin-6 receptor gene polymorphisms and periodontitis in a non-smoking Japanese population.
16817825 2006 Polymorphisms in the interleukin-6 receptor gene are associated with body mass index and with characteristics of the metabolic syndrome.
16794539 2006 Association of high pretransplant sIL-6R plasma levels with acute tubular necrosis in kidney graft recipients.
16731080 2006 Multilocus interactions at maternal tumor necrosis factor-alpha, tumor necrosis factor receptors, interleukin-6 and interleukin-6 receptor genes predict spontaneous preterm labor in European-American women.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16557588 2006 Human T-cell leukemia virus type-I Tax induces expression of interleukin-6 receptor (IL-6R): Shedding of soluble IL-6R and activation of STAT3 signaling.
16372246 2006 Immunoexpression of the CD30 ligand/CD30 and IL-6/IL-6R signals in thyroid autoimmune diseases.
16270750 2005 Increased association with detergent-resistant membranes/lipid rafts of apically targeted mutants of the interleukin-6 receptor gp80.
16127269 Release of interleukin-6 and its soluble receptors by activated peripheral blood monocytes is elevated in hypocholesterolemic hemodialysis patients.
16034137 2005 Bacterial induction of TNF-alpha converting enzyme expression and IL-6 receptor alpha shedding regulates airway inflammatory signaling.
15895091 2005 Signaling conformations of the tall cytokine receptor gp130 when in complex with IL-6 and IL-6 receptor.
15816827 2005 Global gene expression analysis of keloid fibroblasts in response to electron beam irradiation reveals the involvement of interleukin-6 pathway.
15641051 2005 Interleukin-6 receptor shedding is enhanced by interleukin-1beta and tumor necrosis factor alpha and is partially mediated by tumor necrosis factor alpha-converting enzyme in osteoblast-like cells.
15625895 1997 [Study on serum soluble interleukin-6 receptor levels in patients with malignant hematological diseases].
15579373 2005 Normal platelets possess the soluble form of IL-6 receptor.
15562008 2005 Molecular screening and association analyses of the interleukin 6 receptor gene variants with type 2 diabetes, diabetic nephropathy, and insulin sensitivity.
15561970 2004 Variation in the interleukin-6 receptor gene associates with type 2 diabetes in Danish whites.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15456942 2004 Serum interleukin-6 soluble receptor in relation to interleukin-6 in stroke patients.
15306846 2004 Polymorphisms in the IL-6 receptor (IL-6R) gene: strong evidence that serum levels of soluble IL-6R are genetically influenced.
15297310 2004 Combined disruption of both the MEK/ERK and the IL-6R/STAT3 pathways is required to induce apoptosis of multiple myeloma cells in the presence of bone marrow stromal cells.
15284182 2004 IL-6-induced survival of colorectal carcinoma cells is inhibited by butyrate through down-regulation of the IL-6 receptor.
15213442 2004 1H, 15N and 13C backbone assignment of the carboxyl terminal domain of the cytokine binding module of the interleukin-6 receptor.
15166129 2004 A combination of interleukin-6 and its soluble receptor impairs sperm motility: implications in infertility associated with endometriosis.
15100312 2004 Differential regulation of neutrophil-activating chemokines by IL-6 and its soluble receptor isoforms.
15063602 2004 Comparison of serum concentrations of C-reactive protein, TNF-alpha, and interleukin 6 between elderly Korean women with normal and impaired glucose tolerance.
15041717 2004 Association of pre- and postoperative plasma levels of transforming growth factor beta(1) and interleukin 6 and its soluble receptor with prostate cancer progression.
14718574 2004 The human plasma proteome: a nonredundant list developed by combination of four separate sources.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14592826 2004 Receptor synergy of interleukin-6 (IL-6) and insulin-like growth factor-I in myeloma cells that highly express IL-6 receptor alpha [corrected].
14557255 2004 Direct determination of the interleukin-6 binding epitope of the interleukin-6 receptor by NMR spectroscopy.
12917504 2003 Association of polymorphisms in the interleukin 6 receptor complex with obesity and hyperandrogenism.
12857602 2003 Role of interleukin-15 and interleukin-18 in the secretion of sIL-6R and sgp130 by human neutrophils.
12832423 2003 Cellular cholesterol depletion triggers shedding of the human interleukin-6 receptor by ADAM10 and ADAM17 (TACE).
12829785 2003 Hexameric structure and assembly of the interleukin-6/IL-6 alpha-receptor/gp130 complex.
12789531 2003 Increased soluble interleukin-6 receptor in vitreous fluid of proliferative vitreoretinopathy.
12748876 2003 The clinical role of interleukin-6 and interleukin-6 soluble receptor in human follicular fluids.
12748171 2003 An aminopeptidase, ARTS-1, is required for interleukin-6 receptor shedding.
12643274 2003 Signaling of human ciliary neurotrophic factor (CNTF) revisited. The interleukin-6 receptor can serve as an alpha-receptor for CTNF.
12633863 2003 The human interleukin-6 (IL-6) receptor exists as a preformed dimer in the plasma membrane.
12574959 2003 Relationship between circulating serum soluble interleukin-6 receptor and the angiogenic cytokines basic fibroblast growth factor and vascular endothelial growth factor in multiple myeloma.
12553555 2002 Co-expression of interleukin-6 (IL-6) and interleukin-6 receptor (IL-6R) in thyroid nodules is associated with co-expression of CD30 ligand/CD30 receptor.
12553038 Expression of IL-6 receptor in pancreatic cancer: involvement in VEGF induction.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12472176 Effect of IL-18 on the release of IL-6 and its soluble receptors: sIL-6Ralpha and sgp130 by human neutrophils.
12461182 2002 Structure of the extracellular domains of the human interleukin-6 receptor alpha -chain.
12445803 2002 Cerebrospinal fluid and serum protein levels of tumour necrosis factor-alpha (TNF-alpha) interleukin-6 (IL-6) and soluble interleukin-6 receptor (sIL-6R gp80) in multiple sclerosis patients.
12419823 2003 JAK/STAT but not ERK1/ERK2 pathway mediates interleukin (IL)-6/soluble IL-6R down-regulation of Type II collagen, aggrecan core, and link protein transcription in articular chondrocytes. Association with a down-regulation of SOX9 expression.
12414855 2002 Circulating levels of interleukin-6 soluble receptor predict rates of bone loss in patients with primary hyperparathyroidism.
12412787 2002 Role of the interleukin-6/interleukin-6 soluble receptor cytokine system in mediating increased skeletal sensitivity to parathyroid hormone in perimenopausal women.
12372336 2002 Gp130 activation by soluble interleukin-6 receptor/interleukin-6 enhances osteoblastic differentiation of human bone marrow-derived mesenchymal stem cells.
12008038 2002 Soluble interleukin-6 receptor enhanced by oncostatin M induces major changes in gene expression profile of human hepatoma cells.
12002769 2002 Serum soluble IL-6 receptor levels during the mobilization of stem cells to peripheral blood.
11884403 2002 Shedding of the interleukin-6 (IL-6) receptor (gp80) determines the ability of IL-6 to induce gp130 phosphorylation in human osteoblasts.
11238858 2001 Detection of direct binding of human herpesvirus 8-encoded interleukin-6 (vIL-6) to both gp130 and IL-6 receptor (IL-6R) and identification of amino acid residues of vIL-6 important for IL-6R-dependent and -independent signaling.
11017875 2000 The cytoplasmic domain of the interleukin-6 receptor gp80 mediates its basolateral sorting in polarized madin-darby canine kidney cells.
10982829 2000 The coiled-coil domain of Stat3 is essential for its SH2 domain-mediated receptor binding and subsequent activation induced by epidermal growth factor and interleukin-6.
10785334 2000 The distribution of receptors for the pro-inflammatory cytokines interleukin (IL)-6 and IL-8 in the developing human fetus.
10777583 2000 SOCS3 exerts its inhibitory function on interleukin-6 signal transduction through the SHP2 recruitment site of gp130.
10510402 1999 Novel path to activation of vascular smooth muscle cells: up-regulation of gp130 creates an autocrine activation loop by IL-6 and its soluble receptor.
10462375 1999 Modulation of hepatic acute phase gene expression by epidermal growth factor and Src protein tyrosine kinases in murine and human hepatic cells.
10066782 1999 Disulfide bond structure and N-glycosylation sites of the extracellular domain of the human interleukin-6 receptor.
9927325 1999 Human osteoclast-like cells are formed from peripheral blood mononuclear cells in a coculture with SaOS-2 cells transfected with the parathyroid hormone (PTH)/PTH-related protein receptor gene.
9169421 1997 Identification of novel human WW domain-containing proteins by cloning of ligand targets.
8889549 1996 Generation and analysis of 280,000 human expressed sequence tags.
8467812 1993 Structure-function analysis of human IL-6 receptor: dissociation of amino acid residues required for IL-6-binding and for IL-6 signal transduction through gp130.
8428753 1993 The human interleukin-6 receptor alpha chain gene is localized on chromosome 1 band q21.
8265649 1993 Soluble interleukin-6 receptor triggers osteoclast formation by interleukin 6.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
8056053 1994 Soluble interleukin-6 receptors released from T cell or granulocyte/macrophage cell lines and human peripheral blood mononuclear cells are generated through an alternative splicing mechanism.
3136546 1988 Cloning and expression of the human interleukin-6 (BSF-2/IFN beta 2) receptor.
2788034 1989 Interleukin-6 triggers the association of its receptor with a possible signal transducer, gp130.
2529343 1989 Soluble cytokine receptors are present in normal human urine.
2261637 1990 Molecular cloning and expression of an IL-6 signal transducer, gp130.
2157217 1990 Glucocorticoid up-regulation of high-affinity interleukin 6 receptors on human epithelial cells.
2112585 1990 Functional murine interleukin 6 receptor with the intracisternal A particle gene product at its cytoplasmic domain. Its possible role in plasmacytomagenesis.
1889804 1991 The Interleukin-6-dependent DNA-binding protein gene (transcription factor 5: TCF5) maps to human chromosome 20 and rat chromosome 3, the IL6 receptor locus (IL6R) to human chromosome 1 and rat chromosome 2, and the rat IL6 gene to rat chromosome 4.
1872801 1991 Structural and functional studies on the human hepatic interleukin-6 receptor. Molecular cloning and overexpression in HepG2 cells.
1381187 1992 Gene expression of the high molecular weight proteinase inhibitor alpha 2-macroglobulin.
1281789 1992 Ciliary neurotrophic factor induces acute-phase protein expression in hepatocytes.