Property Summary

NCBI Gene PubMed Count 3,552
PubMed Score 28484.71
PubTator Score 22090.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (7)

Disease Target Count
Obesity 616
Atherosclerosis 275
Metabolic syndrome X 155
Pneumonia 133
Osteoporosis 259
psoriasis 6685
Schizophrenia 503
Cholestasis 93
Leishmaniasis 49
Hypercalcemia 37
Acute kidney injury 65
Albuminuria 20
Amnesia 17
Angiolymphoid hyperplasia 1
Arthritis, Experimental 39
Autistic Disorder 320
Autoimmune Diseases 33
Basal cell carcinoma 31
Berylliosis 28
CROHN DISEASE-ASSOCIATED GROWTH FAILURE, SUSCEPTIBILITY TO (finding) 1
Cachexia 10
Cardiomyopathies 90
Cerebrovascular accident 44
Cholangiocarcinoma 32
Colitis 46
Crohn Disease 97
Depressive disorder 48
Dermatitis, Atopic 45
Dermatologic disorders 65
Diabetes Mellitus, Experimental 106
Diabetes Mellitus, Non-Insulin-Dependent 161
Diaphragmatic Hernia 40
Drug-Induced Liver Injury 118
Edema 38
Entamoebiasis 6
Fever 34
Glomerulonephritis 36
HIV Wasting Syndrome 4
Headache 5
Heart failure 80
Heat Stroke 12
Hepatitis, Autoimmune 17
Hepatolenticular Degeneration 24
Hyperalgesia 71
Hyperoxaluria 5
Hyperparathyroidism, Secondary 5
Hypersensitivity 63
Hypoalbuminemia 3
Hypotension 53
Infarction, Middle Cerebral Artery 25
Inflammation 109
Inflammatory Bowel Diseases 87
Intracranial Arteriovenous Malformation 1
Ischemia 27
Kaposi Sarcoma 1
Kidney Failure, Chronic 45
Leishmaniasis, Visceral 13
Lichenoid Eruptions 2
Liver Cirrhosis 101
Liver Cirrhosis, Alcoholic 16
Liver carcinoma 217
Lung Injury 20
Lung Neoplasms 171
Lupus Erythematosus, Systemic 73
Mammary Neoplasms 410
Mitochondrial Myopathies 6
Multiple myeloma 1328
Myocardial Infarction 126
Myocardial Ischemia 169
Necrosis 51
Neoplasm Invasiveness 127
Neoplasm Metastasis 138
Neoplastic Cell Transformation 81
Neurodegenerative Disorders 37
Osteoporosis, Postmenopausal 7
Parkinson Disease 105
Peripheral Neuropathy 303
Pleurisy 18
Polymyositis 5
Pregnancy Complications, Cardiovascular 4
Premature Birth 9
Premature Obstetric Labor 2
Prostatic Neoplasms 471
Pulmonary Fibrosis 66
Renal Cell Carcinoma 199
Reperfusion Injury 84
Respiratory Hypersensitivity 18
Rheumatoid Arthritis 1171
Seizures 95
Shock, Hemorrhagic 7
Spontaneous abortion 108
Squamous cell carcinoma 96
Stomach Neoplasms 282
Thyroid Neoplasm 33
Ventricular Dysfunction, Left 15
chronic lymphocytic leukemia 244
hemolytic-uremic syndrome 28
ovarian neoplasm 97
Disease Target Count P-value
non-small cell lung cancer 2798 1.17390886470106E-13
malignant mesothelioma 3163 1.25884501457377E-7
lung cancer 4473 2.62506145417202E-7
lung adenocarcinoma 2714 2.90676075708316E-7
lung carcinoma 2844 3.97549817640486E-6
posterior fossa group A ependymoma 1511 4.61153025185136E-4
inflammatory breast cancer 404 0.00194286790196172
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00289279235955259
interstitial cystitis 2299 0.0037178082727391
ulcerative colitis 2087 0.00586037360988623
non diabetic and post-ischemic heart failure 200 0.00616208530980715
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00714378505295262
Waldenstrons macroglobulinemia 765 0.0196235078977738
pituitary cancer 1972 0.020325014711957
invasive ductal carcinoma 2950 0.0266974744409572
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0286374733795519
Bipolar Disorder 266 0.035617088191269
type II diabetes mellitus and post-ischemic heart failure 89 0.0391670295790808
Disease Target Count Z-score Confidence
Juvenile rheumatoid arthritis 105 0.0 5.0
Type 1 diabetes mellitus 104 0.0 5.0
Disease Target Count Z-score Confidence
Arthritis 248 6.896 3.4
Cancer 2346 6.776 3.4
diabetes mellitus 1663 6.115 3.1
Inflammatory bowel disease 142 5.98 3.0
Coronary artery disease 240 5.945 3.0
Hypersensitivity reaction type II disease 235 5.822 2.9
Kidney disease 397 5.781 2.9
periodontitis 269 5.637 2.8
Pancreatitis 97 5.373 2.7
Hypertension 293 5.364 2.7
Cerebrovascular disease 231 5.306 2.7
Heart disease 279 5.305 2.7
Liver disease 219 5.256 2.6
Chorioamnionitis 15 5.215 2.6
Peritonitis 37 5.164 2.6
Asthma 349 5.077 2.5
Anemia 252 5.03 2.5
Chronic obstructive pulmonary disease 147 4.97 2.5
Influenza 142 4.852 2.4
Multiple Sclerosis 498 4.832 2.4
Brain disease 84 4.752 2.4
Acquired immunodeficiency syndrome 164 4.705 2.4
Vasculitis 64 4.694 2.3
Alzheimer's disease 644 4.63 2.3
Hyperglycemia 120 4.607 2.3
Meningitis 46 4.605 2.3
Dermatitis 141 4.568 2.3
Respiratory failure 30 4.532 2.3
Synovitis 72 4.502 2.3
tuberculosis 1563 4.477 2.2
interstitial lung disease 292 4.459 2.2
Fatty liver disease 86 4.372 2.2
Leukopenia 42 4.361 2.2
Collagen disease 25 4.333 2.2
Lipid metabolism disorder 102 4.326 2.2
Uveitis 103 4.318 2.2
Endometriosis 535 4.286 2.1
Funisitis 8 4.259 2.1
Obstructive sleep apnea 28 4.23 2.1
Thrombocytopenia 105 4.192 2.1
Allergic hypersensitivity disease 123 4.17 2.1
Myopathy 128 4.099 2.0
Cystitis 16 4.089 2.0
Kawasaki disease 24 4.054 2.0
Malaria 140 3.977 2.0
Perinatal necrotizing enterocolitis 18 3.966 2.0
Dry eye syndrome 14 3.879 1.9
Dementia 129 3.851 1.9
Bacterial vaginosis 15 3.845 1.9
Major Depressive Disorder 106 3.842 1.9
Diarrhea 155 3.803 1.9
Aortic aneurysm 34 3.798 1.9
Toxic encephalopathy 131 3.792 1.9
Neuropathy 210 3.716 1.9
Toxic shock syndrome 28 3.702 1.9
Hepatitis B 103 3.685 1.8
cystic fibrosis 1670 3.681 1.8
Parasitic helminthiasis infectious disease 13 3.66 1.8
Keratitis 42 3.63 1.8
Pain agnosia 99 3.588 1.8
Exanthem 39 3.547 1.8
Diabetic Retinopathy 53 3.535 1.8
Common cold 63 3.531 1.8
Allergic rhinitis 92 3.53 1.8
Mastitis 48 3.515 1.8
Hepatitis C 90 3.514 1.8
Tetanus 66 3.496 1.7
Primary immunodeficiency disease 52 3.489 1.7
POEMS syndrome 6 3.428 1.7
Gingivitis 19 3.42 1.7
Peripheral vascular disease 90 3.413 1.7
Ankylosing spondylitis 138 3.398 1.7
Hemophagocytic lymphohistiocytosis 30 3.386 1.7
Arthropathy 34 3.385 1.7
Disseminated intravascular coagulation 32 3.381 1.7
Gastritis 44 3.354 1.7
Infertility 163 3.337 1.7
Otitis media 32 3.283 1.6
Candidiasis 48 3.271 1.6
Intestinal obstruction 16 3.266 1.6
Polycystic Ovary Syndrome 335 3.255 1.6
Psoriatic arthritis 85 3.25 1.6
Polyclonal hypergammaglobulinemia 5 3.248 1.6
Macular retinal edema 11 3.245 1.6
Parkinson's disease 364 3.218 1.6
Listeriosis 17 3.192 1.6
Cholangitis 20 3.188 1.6
Eosinophilia 65 3.185 1.6
Appendicitis 18 3.173 1.6
Lyme disease 23 3.161 1.6
Hyperinsulinism 63 3.156 1.6
Takayasu's arteritis 54 3.148 1.6
sarcoidosis 368 3.134 1.6
Bronchitis 44 3.123 1.6
Chronic fatigue syndrome 29 3.122 1.6
Prostatitis 15 3.101 1.6
Amyloidosis 68 3.072 1.5
Bacteriuria 13 3.067 1.5
Endometritis 21 3.057 1.5
Euthyroid sick syndrome 5 3.038 1.5
Degenerative disc disease 28 3.035 1.5

Expression

See source...

Synonym

Accession P05231 Q9UCU2 Q9UCU3 Q9UCU4 IL-6
Symbols CDF
HGF
HSF
BSF2
IL-6
BSF-2
IFNB2
IFN-beta-2

Gene

IL6

PDB

1N2Q   1P9M   1ALU   1IL6   2IL6   4CNI   4J4L   4NI7   4NI9   4O9H   4ZS7  

  Ortholog (10)

Gene RIF (3928)

PMID Text
27468568 Culture conditions affect Il6 secretion by stem cells to be used in treating myocardial infarction and may affect treatment outcome.
27296261 There was an association of the polymorphism G(-174)C of the IL-6 gene with the clinical features of Chronic Glomerulonephritis and a response to immunosuppressive therapy .
27049557 The results of this study indicated that IL-6 promoter -174 polymorphisms may play a role in susceptibility to stroke, but not stroke outcome.
27030742 Glioma stem cells, but not the bulk glioma cells, initiate microglial IL-6 secretion which regulates glioma growth.
27016501 Studies indicate that interleukin 6 (IL-6) is a central player in physiological neuronal and glial function as well as neuroinflammatory pathways observed in diseases of the central nervous system..
27012192 that the expression of ERG in prostate cancer is linked to the expression of IL-6 mediated by the prostanoid receptor EP2
27010153 The levels of ESM1, CLDN5, IL-1beta, IL-6, and TNF-alpha were significantly higher in the migraine attack group than in the control group
26960986 Presence of G allele or GG genotype at the -174 and the GG genotype at the -597 positions of the promoter region of the interleukin-6 gene constitute risk factors for developing febrile seizures in Egyptian children.
26945971 IL-6 is a contributing factor for multidrug resistance in cancer due to gp130/MAPK/STAT3 mediated activation of transcription factors, overexpression of p-glycoprotein, epithelial to mesenchymal transition and expansion of stem cells. [Review]
26911440 common functional variant on the pro-inflammatory Interleukin-6 gene may modify the association between long-term PM10 exposure and diabetes
More...

AA Sequence

MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKE      1 - 70
TCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQA     71 - 140
RAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALR    141 - 210
QM                                                                        211 - 212
//

Text Mined References (3555)

PMID Year Title
27468568 2016 Analysis of Ambient Influences Affecting Interleukin-6 Secretion in the Context of Clinical Trials of Stem Cell Therapy for Myocardial Infarction.
27296261 2016 [Clinical value of TNF, IL-6, and IL-10 gene polymorphic markers in chronic glomerulonephritis].
27049557 2016 Interleukin 6 promoter 174 G/C polymorphisms in acute ischemic stroke: G allele is protective but not associated with IL-6 levels or stroke outcome.
27030742 2016 Glioma Stem Cells but Not Bulk Glioma Cells Upregulate IL-6 Secretion in Microglia/Brain Macrophages via Toll-like Receptor 4 Signaling.
27016501 2016 The role of interleukin-6 signaling in nervous tissue.
27012192 2016 IL-6 Overexpression in ERG-Positive Prostate Cancer Is Mediated by Prostaglandin Receptor EP2.
27010153 2016 Serum levels of endocan, claudin-5 and cytokines in migraine.
26960986 2016 Interleukin-6 gene polymorphisms in Egyptian children with febrile seizures: a case-control study.
26945971 2016 Cancer development, chemoresistance, epithelial to mesenchymal transition and stem cells: A snapshot of IL-6 mediated involvement.
26911440 2016 A common functional variant on the pro-inflammatory Interleukin-6 gene may modify the association between long-term PM10 exposure and diabetes.
More...