Property Summary

Ligand Count 12
NCBI Gene PubMed Count 3,909
PubMed Score 30968.85
PubTator Score 22090.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Obesity 678 6.379 3.2
Atherosclerosis 291 6.202 3.1
Hypertension 396 5.461 2.7
Pneumonia 174 5.445 2.7
Osteoporosis 363 4.769 2.4
psoriasis 6694 4.639 3.10368785981238E-4
Schizophrenia 1160 3.682 1.8
Cholestasis 155 3.591 1.8
Leishmaniasis 47 3.299 1.6
Hypercalcemia 59 3.154 1.6
Brain Ischemia 110 3.083 1.5
Abortion, Spontaneous 109 0.0 0.0
Acute coronary syndrome 39 0.0 0.0
Acute kidney injury 70 0.0 0.0
Albuminuria 21 0.0 0.0
Amnesia 17 0.0 0.0
Arthritis, Experimental 39 0.0 0.0
Arthritis, Rheumatoid 174 0.0 0.0
Autistic Disorder 364 0.0 0.0
Autoimmune Diseases 67 0.0 0.0
Berylliosis 28 0.0 0.0
Brain Injuries 65 0.0 0.0
Breast Neoplasms 445 0.0 0.0
Burns 9 0.0 0.0
Burns, Chemical 6 0.0 0.0
Cachexia 50 0.0 0.0
Carcinoma, Basal Cell 28 0.0 0.0
Carcinoma, Hepatocellular 228 0.0 0.0
Carcinoma, Renal Cell 124 0.0 0.0
Carcinoma, Squamous Cell 110 0.0 0.0
Cardiomyopathies 110 0.0 0.0
Castleman Disease 1 0.0 0.0
Cell Transformation, Neoplastic 97 0.0 0.0
Chemical and Drug Induced Liver Injury 195 0.0 0.0
Cholangiocarcinoma 35 0.0 0.0
Cholestasis, Extrahepatic 25 0.0 0.0
Colitis 54 0.0 0.0
Coxsackievirus Infections 6 0.0 0.0
Crohn Disease 45 0.0 0.0
Depressive disorder 409 0.0 0.0
Dermatitis, Atopic 37 0.0 0.0
Diabetes Mellitus, Experimental 108 0.0 0.0
Edema 81 0.0 0.0
Entamoebiasis 6 0.0 0.0
Fever 138 0.0 0.0
Glomerulonephritis 46 0.0 0.0
HIV Wasting Syndrome 4 0.0 0.0
Headache 37 0.0 0.0
Heart failure 162 0.0 0.0
Heat Stroke 13 0.0 0.0
Hemolytic-Uremic Syndrome 30 0.0 0.0
Hepatitis, Autoimmune 17 0.0 0.0
Hepatolenticular Degeneration 24 0.0 0.0
Hernia, Diaphragmatic 40 0.0 0.0
Hyperalgesia 83 0.0 0.0
Hyperoxaluria 8 0.0 0.0
Hyperparathyroidism, Secondary 7 0.0 0.0
Hypersensitivity 63 0.0 0.0
Hypoalbuminemia 24 0.0 0.0
Hypotension 82 0.0 0.0
Infarction, Middle Cerebral Artery 33 0.0 0.0
Inflammation 120 0.0 0.0
Inflammatory Bowel Diseases 35 0.0 0.0
Intracranial Arteriovenous Malformations 1 0.0 0.0
Ischemia 28 0.0 0.0
Kidney Failure, Chronic 46 0.0 0.0
Leishmaniasis, Visceral 13 0.0 0.0
Leukemia, Lymphocytic, Chronic, B-Cell 34 0.0 0.0
Lichenoid Eruptions 2 0.0 0.0
Liver Cirrhosis 181 0.0 0.0
Liver Cirrhosis, Alcoholic 16 0.0 0.0
Liver Neoplasms, Experimental 59 0.0 0.0
Lung Injury 20 0.0 0.0
Lung Neoplasms 232 0.0 0.0
Lupus Erythematosus, Systemic 67 0.0 0.0
Meningitis, Aseptic 2 0.0 0.0
Mesothelioma, Malignant 105 0.0 0.0
Metabolic Syndrome 20 0.0 0.0
Mitochondrial Myopathies 21 0.0 0.0
Multiple myeloma 1332 0.0 0.0
Myocardial Infarction 151 0.0 0.0
Myocardial Ischemia 169 0.0 0.0
Myocarditis 18 0.0 0.0
Necrosis 53 0.0 0.0
Neoplasm Invasiveness 161 0.0 0.0
Neoplasm Metastasis 168 0.0 0.0
Neurodegenerative Diseases 38 0.0 0.0
Obstetric Labor, Premature 2 0.0 0.0
Osteoporosis, Postmenopausal 6 0.0 0.0
Ovarian Neoplasms 102 0.0 0.0
Parkinson Disease 64 0.0 0.0
Peripheral Nervous System Diseases 52 0.0 0.0
Pleural Diseases 10 0.0 0.0
Pleurisy 19 0.0 0.0
Polymyositis 5 0.0 0.0
Precancerous Conditions 80 0.0 0.0
Pregnancy Complications, Cardiovascular 4 0.0 0.0
Premature Birth 77 0.0 0.0
Prostatic Neoplasms 495 0.0 0.0
Pulmonary Disease, Chronic Obstructive 31 0.0 0.0
Pulmonary Fibrosis 106 0.0 0.0
Reperfusion Injury 86 0.0 0.0
Respiratory Hypersensitivity 19 0.0 0.0
Rheumatoid Arthritis, Systemic Juvenile 16 0.0 0.0
Sarcoma, Kaposi 1 0.0 0.0
Seizures 596 0.0 0.0
Shock, Hemorrhagic 7 0.0 0.0
Skin Diseases 71 0.0 0.0
Stomach Neoplasms 300 0.0 0.0
Stroke 33 0.0 0.0
Thyroid Neoplasms 34 0.0 0.0
Tobacco Use Disorder 12 0.0 0.0
Ventricular Dysfunction, Left 22 0.0 0.0
Wounds and Injuries 18 0.0 0.0
Disease Target Count Z-score Confidence
Type 1 diabetes mellitus 109 0.0 5.0
Disease Target Count Z-score Confidence
Arthritis 290 6.987 3.5
Cancer 2499 6.829 3.4
diabetes mellitus 1728 6.221 3.1
Inflammatory bowel disease 151 6.092 3.0
Coronary artery disease 268 6.0 3.0
Kidney disease 430 5.883 2.9
Hypersensitivity reaction type II disease 253 5.876 2.9
periodontitis 293 5.746 2.9
Pancreatitis 123 5.447 2.7
Cerebrovascular disease 238 5.389 2.7
Heart disease 306 5.387 2.7
Liver disease 237 5.368 2.7
Chorioamnionitis 14 5.254 2.6
Peritonitis 43 5.211 2.6
Asthma 385 5.182 2.6
Chronic obstructive pulmonary disease 184 5.13 2.6
Anemia 365 5.079 2.5
Influenza 142 4.932 2.5
Multiple Sclerosis 540 4.902 2.5
Brain disease 96 4.891 2.4
Vasculitis 80 4.77 2.4
Hyperglycemia 137 4.758 2.4
Acquired immunodeficiency syndrome 197 4.756 2.4
Respiratory Failure 104 4.702 2.4
Alzheimer's disease 658 4.701 2.4
Dermatitis 157 4.682 2.3
Meningitis 67 4.63 2.3
Synovitis 78 4.596 2.3
interstitial lung disease 298 4.542 2.3
Fatty liver disease 103 4.513 2.3
Thrombocytosis 38 4.459 2.2
Collagen disease 27 4.442 2.2
Leukopenia 72 4.432 2.2
Uveitis 103 4.412 2.2
Lipid metabolism disorder 114 4.396 2.2
Obstructive sleep apnea 26 4.354 2.2
Endometriosis 540 4.312 2.2
Funisitis 7 4.293 2.1
Allergic hypersensitivity disease 126 4.28 2.1
Thrombocytopenia 197 4.203 2.1
Cystitis 15 4.177 2.1
Myopathy 185 4.176 2.1
Kawasaki disease 28 4.115 2.1
Perinatal necrotizing enterocolitis 21 4.104 2.1
Malaria 160 4.04 2.0
Aortic aneurysm 38 3.98 2.0
Dry eye syndrome 18 3.974 2.0
Toxic encephalopathy 141 3.941 2.0
Diarrhea 253 3.939 2.0
Dementia 175 3.927 2.0
Bacterial vaginosis 15 3.859 1.9
Lymphoproliferative syndrome 58 3.857 1.9
Neuropathy 261 3.856 1.9
Pain agnosia 104 3.793 1.9
Diabetic retinopathy 56 3.727 1.9
Hepatitis B 108 3.72 1.9
Keratitis 62 3.709 1.9
Parasitic helminthiasis infectious disease 15 3.693 1.8
Mastitis 48 3.67 1.8
Exanthem 37 3.638 1.8
Common cold 69 3.617 1.8
Allergic rhinitis 95 3.589 1.8
Toxic shock syndrome 28 3.57 1.8
Hepatitis C 94 3.557 1.8
Tetanus 68 3.55 1.8
Gingivitis 29 3.507 1.8
Gastritis 47 3.498 1.7
Ankylosing spondylitis 140 3.489 1.7
Arthropathy 43 3.483 1.7
Peripheral vascular disease 87 3.444 1.7
Takayasu's arteritis 53 3.443 1.7
Disseminated intravascular coagulation 38 3.442 1.7
Parkinson's disease 392 3.441 1.7
Intestinal Obstruction 31 3.419 1.7
Hemophagocytic lymphohistiocytosis 30 3.413 1.7
Polycystic ovary syndrome 360 3.412 1.7
Infertility 188 3.391 1.7
POEMS syndrome 6 3.383 1.7
Psoriatic arthritis 86 3.382 1.7
Degenerative disc disease 35 3.329 1.7
Bronchitis 43 3.323 1.7
Otitis Media 52 3.313 1.7
Candidiasis 55 3.299 1.6
Prostatitis 18 3.299 1.6
Cholangitis 32 3.269 1.6
Listeriosis 18 3.268 1.6
Hyperinsulinism 133 3.258 1.6
Hypereosinophilic syndrome 71 3.249 1.6
Macular retinal edema 13 3.233 1.6
Polyclonal hypergammaglobulinemia 5 3.226 1.6
Osteomyelitis 42 3.223 1.6
Appendicitis 15 3.206 1.6
sarcoidosis 370 3.2 1.6
Bacteriuria 8 3.153 1.6
Endometritis 21 3.137 1.6
Lyme disease 26 3.129 1.6
Amyloidosis 67 3.128 1.6
Chronic fatigue syndrome 25 3.121 1.6
Neuromyelitis optica 18 3.112 1.6
Polyneuropathy 64 3.087 1.5
Mucositis 29 3.037 1.5
Macular holes 11 3.032 1.5
Euthyroid sick syndrome 5 3.023 1.5
Age related macular degeneration 72 3.01 1.5
Dengue disease 23 3.008 1.5
Retinal Detachment 51 3.001 1.5

Expression

  Differential Expression (21)

See source...

Gene RIF (4287)

AA Sequence

MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKE      1 - 70
TCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQA     71 - 140
RAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALR    141 - 210
QM                                                                        211 - 212
//

Text Mined References (3912)

PMID Year Title