Property Summary

NCBI Gene PubMed Count 400
PubMed Score 144.07
PubTator Score 527.93

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
Waldenstrons macroglobulinemia -2.633 1.5e-04
malignant mesothelioma 1.100 5.2e-06
psoriasis 1.700 4.4e-04
osteosarcoma -1.476 1.7e-04
Atopic dermatitis 1.300 9.8e-05
primary pancreatic ductal adenocarcinoma 1.037 9.5e-03
lung cancer -2.200 1.2e-04
lung carcinoma -2.400 1.5e-27
spina bifida 1.162 2.3e-02
gastric carcinoma 1.200 1.7e-02
mucosa-associated lymphoid tissue lympho... 1.187 1.0e-02
ovarian cancer 1.200 4.1e-04
Breast cancer -1.200 6.0e-03
pancreatic cancer 1.100 1.1e-02

Gene RIF (382)

PMID Text
26831416 investigated five SNPs (C-589T and C-33T of IL4, G+2044A of IL13, A+1902G of IL4Ralpha, and A+896G of TLR4) in patients with adult onset asthma to evaluate their role in manifestation and severity of asthma
26695670 There is no correlation between the Arg551Gln polymorphism in IL-4R gene and asthma predictive index results
26693492 genetic polymorphism is associated with autoimmune hepatitis in Brazilian children
26667837 IL4Rrs2107356 and IL8rs2227307 SNPs were associated with an increased risk of invasive aspergillosis.
26437765 Genetic variants of NOS3, CD14, MMP3 and IL4R are implicated in the determination of VEGF expression and plasma levels.
26306492 Essential role of endocytosis for interleukin-4-receptor-mediated JAK/STAT signalling.
26281177 Study results have demonstrated, that of all investigated polymorphic variants of genes IL4 (C-590T), IL4RA (150V), TNF (G-308A) and SLC11A1 (D543N) in patients with chronic liver diseases of various etiology
26187331 review of IL-4 and IL-13 receptor structure, receptor regulation, signaling and experimental therapeutics [review]
26088753 analysis of IL-4 and IL-13 receptors in cancer biology and discussion of pre-clinical and clinical studies pertaining to recombinant immunotoxins designed to target these receptors [review]
25867440 Studies indicate significant association between the interleukin-4receptor (IL-4R) Q576R polymorphism and the risk of asthma in the Chinese Han population.
25769611 Selective augmentation of IL-4Ralpha signaling in Treg cells induced their reprogramming into Th2-like cells and disease susceptibility towards food allergy.
25746764 IL4R mediates enhanced glucose and glutamine metabolism in breast cancer cells.
25483786 Data show that high expression of interleukin-4 receptor IL-4Ralpha correlated with increased recurrence, while interleukin-13 receptor IL-13Ralpha1 had an inverse relationship to recurrence and survival in oral cavity squamous cell carcinoma patients.
25468331 Receptor trafficking may play an important role for the regulation of IL-4R-mediated JAK/STAT signaling.
25252624 Gene interactions were observed between IL4R and TNF-alpha genes in hand osteoarthritis patients.
25170298 The findings suggest that the T allele of the SNP C-33T in the IL-4 gene and the C allele of the SNP S503P in IL-4R may have a protective role against glioma development.
25110223 higher frequency of polymorphisms in patients with familial hypercholesterolemia
24975796 increased expression in B cells of patients with house dust mites allergic asthma
24960198 These results suggest that IL-4Ralpha locating in non-lipid raft region is a target molecule for strictinin in inhibiting STAT6 activation.
24803421 Analysis of IL4R SNP haplotypes or complex alleles suggested no dominant protection in patients with Recurrent spontaneous abortion
24782180 Increased Th17 cell frequency and poor clinical outcome in rheumatoid arthritis are associated with a genetic variant in the IL4R gene, rs1805010.
24742632 the IL-4Ralpha and the STAT6 polymorphism may play a role in susceptibility to AD. In addition, gene-gene interaction between the IL-4, the IL-4Ralpha and the STAT6 significantly increases an individual's susceptibility to AD.
24510574 Rs1805012 polymorphism of IL-4R gene is associated with asthma.
24386991 beta-defensin-2 and interleukin-4 receptor are biomarkers that improve the prediction of poor-outcome over clinical variables in the acute phase of stroke
24339977 The binding of [AP1-V12]6 to cancer cells was remarkably reduced when IL-4 receptors were blocked by antibody against IL-4 receptor further confirmed its binding
24185116 Higher TGF-beta with lower CD124 and TSLP, but no difference in PAR-2 expression in bronchial biopsy of bronchial asthma patients in comparison with COPD patients.
24056919 Results suggest that the physical interaction between the cytoplasmic domains of IL-13Ralpha2 and IL-4Ralpha regulates IL-4 signaling through the IL-4Ralpha-IL-13Ralpha1 receptor complex.
23983153 Genetic variants in IL4R were identified, and their association with the progression rate of joint damage in rheumatoid arthritis was independently replicated.
23979976 the polymorphism of IL-4Ralpha rs1801275 confers individual's variable susceptibility to glioma, particularly among Asians.
23972290 This meta-analysis indicates that the I50V polymorphism of IL-4R gene may confer susceptibility to RA
23924473 Polymorphisms rs2243250 and rs2070874 of IL-4 and rs1801275 and rs1805011 of IL4R were associated with asthma.
23922687 The IL4RA I50V and Q551R polymorphisms may be risk factors for developing asthma.
23883285 The IL-4 -590 T/C polymorphism is associated with susceptibility to rheumatoid arthritis (RA) in Europeans, but the IL-4R 1902 G/A polymorphism is not associated with RA in Europeans.
23784081 reduced IL-4R signalling has stage-specific effects on colorectal carcinogenesis (increased CRC initiation and risk but reduced tumour progression and no effect on CRC mortality).
23774696 Results illustrated that Saudi vitiligo patients showed significantly higher frequency of the IL-4R (Q551R A>G) homozygous GG variant (recessive mode) as compared with their respective controls
23663500 The rs1801275 in IL-4R showed an increased risk of glioblastoma.
23557074 IL-4RA-1902 A/A genotype has been associated with a reduced response to IL-4 and has been found in 90% oral mucous membrane pemphigoid patient
23543769 These findings support a pathogenic role for IL-4Ralpha on Th cells following respiratory syncytial virus reinfection
23527710 TNF-alpha-308A and -238A, IL-4-590T, IL-4Ralpha+1902, and IL-1alpha-889C polymorphisms are positively associated with clinically relevant asthma in Italian caucasians
23525950 Single nucleotide polymorphisms in IL4R gene is associated with the risk of adult glioma.
23480403 Data indicate that single nucleotide polymorphism (SNP) rs1805015 in the IL4Ralpha gene was significantly associated with eczema in the additive and dominant models.
23395224 An meta-analysis suggests that the IL-4Ralpha rs1801275 polymorphism is not a genetic predictor for glioma.
23383283 Reduced interleukin-4 receptor alpha expression on CD8+ T cells correlates with higher quality anti-viral immunity.
23376457 Data suggest that genetic variability of the IL4/IL4R could have an effect in the clinical course of the disease instead of increasing or decreasing the susceptibility to endemic pemphigus foliaceus.
23217179 The IL1B gene -5839C > T and IL4R 1902A > G polymorphisms and IL12RB1 -1094A/-641C and TNF -1031 T/-863A/-857 T/-308 G/-238 G haplotypes were associated with malaria susceptibility.
23066418 Passive smoking causes significant rise in plasma TNFa and IL4 with a dose dependent effect
22997428 patients' sera inhibited STAT6 phosphorylation induced by IL4 binding to CD124, demonstrating that these autoantibodies are functional and suggesting that IL4 neutralization has a pathogenetic role in Autoimmune hepatitis.
22902050 A protective association for Hodgkin lymphoma was observed on the IL4R gene with haplotype TCA
22891178 A significant association between IL-4R -3223C to T polymorphism and risk of gastric cancer was found.
22764749 Interacting determinants of atopy, total IgE, IgE against prevalent allergens, and IL4RA polymorphisms, contribute to the high prevalence of betalactams allergy in South of Spain.
22705603 This study provides evidence for a significant association of IL-4R (Q551R A/G) genetic polymorphisms with the susceptibility rather than the severity of acne vulgaris
22633285 results reveal that IL-4Ralpha may play certain roles in the lipid metabolism of Taiwanese population and suggest a novel link between lipid metabolism and the cytokine receptor
22541248 Subjects homozygous for the IL4RA rs8832 common G allele randomized to pitrakinra had decreased asthma exacerbations and decreased nocturnal awakenings and activities limited by asthma.
22484276 Genetic determinants IL-4 and IL-4R, may contribute to high anti-hepatitis B titers in immune responses to hepatitis B vaccinations.
22441356 Expression of IL-4, IL-4R, and IL-13R are involved in the process of local metastases in colorectal cancer, while IL-13 expression has an impact on survival.
22376040 In Korean asthmatic children, increased serum IgE level was a multi-locus interaction between IL-4Ralpha, IL-13, IL-13Ralpha1, CD14, and CTLA4 polymorphisms. The combination of CTLA4/IL-13 and IL-13/IL-13Ralpha1 polymorphisms showed strong synergistic effects.
22369735 we found three protective alleles for glioma patients, including the allele ''G'' of rs1801275 in the IL4R gene by allele model and dominant model analysis
22355322 Single nucleotide polymorphism in IL4R alpha is associated with asthma susceptibility through gene-gene interactions.
22317767 Individuals with IL-4R Ile50Val CT/TT genotypes had a 0.34-fold significantly decreased renal cell cancer risk, and the T variant allele was associated with a decreased risk of RCC in a dose-response manner.
22261806 Tumor expression of IL-4Ralpha is inversely correlated with survival in patients undergoing surgical resection for epithelial MPM.
22170601 Polymorphisms of IL-4, IL-4R and IL-13 genes predicted Chinese bladder cancer risk in 817 bladder cancer and 1,141 controls, were examined.
22119518 reduced responsiveness to interleukin-4 because the I75V polymorphism may contribute to the pathogenesis of myasthenia gravis
22098734 The data provide evidence for codiffusion of IL-4-A647 bound IL-4Ralpha and the type II subunit IL-13Ralpha1 fused to enhanced green fluorescent protein.
22087298 there was no significant association of the IL13 and IL4RA polymorphisms with mite-sensitized persistent allergic rhinitis
22059556 Transfectants expressing the single nucleotide polymorphism in FCER2 exhibited increased IL-4Ralpha expression after stimulation through CD23 compared with wild-type.
22045834 Data showed that polymorphisms in IL4, IL13, and their receptors do not play a role in SSc and do not influence the expression of their corresponding transcript in peripheral blood cells.
21918367 Interactions of the IL-4RA loci may play a role both conferring susceptibility and modulating severity of Atopic dermatitis (AD).
21913997 did not identify any SNPs in the IL-4, IL-4R and IL-13Ralpha2 genes that were associated with atopic dermatitis
21734400 Studies indicate that RAD50 and PTPRE of crude associations with asthma at a Bonferroni-corrected level of significance, while IL4R, CCL5 and TBXA2R of nominal significance.
21733492 The Q551R IL-4RA polymorphism is a putative risk indicator for severe chronic periodontitis, but was not significant associated to AP.
21729106 IL4RA polymorphism may make a modest but significant contribution to a person's genetic susceptibility to chagasic cardiomyopathy.
21536546 IL-4R drives dedifferentiation, mitogenesis, and metastasis in rhabdomyosarcoma.
21497535 IL-4Ralpha polymorphisms were associated with susceptibility to rheumatoid arthritis and may be helpful in early detection of erosive rheumatoid arthritis.
21489615 Single nucleotide polymorphisms of CD14, IL-13 and IL-4 receptor are associated with hexamethylene diisocyanate asthma.
21251883 We found that levels of sIL-4R were strikingly reduced in all forms of TB, particularly meningeal.
21211370 IL-4RA Q576R polymorphisms impart a modest yet significant risk for asthma.
21071541 Observational study of gene-disease association. (HuGE Navigator)
21070662 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
21061265 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
21054877 Observational study of gene-disease association. (HuGE Navigator)
20811626 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20729386 Data show differences in IL-4/IL-13 receptor subunit expression and responsiveness to IL-4 based on the extent of airway epithelial cell differentiation and suggest that these differences may have functional consequences in airway inflammation.
20716621 Observational study of gene-disease association. (HuGE Navigator)
20703737 Observational study of gene-disease association. (HuGE Navigator)
20673868 Observational study of gene-disease association. (HuGE Navigator)
20654748 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20603050 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20603037 Observational study of gene-disease association. (HuGE Navigator)
20568250 Observational study of gene-disease association. (HuGE Navigator)
20536507 Observational study of gene-disease association. (HuGE Navigator)
20517665 Observational study of gene-disease association. (HuGE Navigator)
20503287 Observational study of gene-disease association. (HuGE Navigator)
20484924 IL4R polymorphisms were associated with asthma in the asthma
20484924 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20459687 Observational study of gene-disease association. (HuGE Navigator)
20453000 Observational study of gene-disease association. (HuGE Navigator)
20452482 Observational study of gene-disease association. (HuGE Navigator)
20444266 IL4R SNPs, rs1801275 and rs1805010, are associated with rheumatoid nodules in autoantibody-positive African-American rheumatoid arthritis patients with at least one HLA-DRB1 allele encoding the shared epitope.
20444266 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20424473 Observational study of gene-disease association. (HuGE Navigator)
20417488 Observational study of gene-disease association. (HuGE Navigator)
20416077 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20394509 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20378664 Observational study of gene-disease association. (HuGE Navigator)
20299965 Observational study of gene-disease association. (HuGE Navigator)
20298583 Observational study of gene-disease association. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
20219689 Observational study of gene-disease association. (HuGE Navigator)
20213229 Observational study of gene-disease association. (HuGE Navigator)
20176658 Proliferation appears to be directly mediated via IL4Ralpha on the epithelial tumor cells
20163933 Observational study of gene-disease association. (HuGE Navigator)
20140262 Observational study of gene-disease association. (HuGE Navigator)
20128416 association between promoter polymorphisms and asthma in Iranian patients
20085599 Significant associations of single nucleotide polymorphisms with wheeze in the past year were detected in only four genes (IL4R, TLR4, MS4A2, TLR9). Variants in IL4R and TLR4 were also related to allergen-specific IgE.
20085599 Observational study of gene-disease association. (HuGE Navigator)
20072140 Observational study of gene-disease association. (HuGE Navigator)
20040389 Data show that flavones inhibited the phosphorylation of STAT6, janus kinase 3, and IL-4Ralpha, whereas IL-4 signaling mediated through type II IL-4R was unaffected by flavones.
20002627 Variations within the IL4R gene are associated with allergic diseases in children, preferably with eczema and disease phenotypes of ARC and asthma.
20002627 Observational study of gene-disease association. (HuGE Navigator)
19956098 38 single-nucleotide polymorphisms in IL4R were genotyped using the Sequenom iPLEX Gold MassARRAY technology in 2042 multiplex families from nine cohorts.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19863607 The results suggest that the genetic polymorphisms of IL-4R and TGF-beta1 are associated with the risk of colorectal cancer in a Korean population.
19863607 Observational study of gene-disease association. (HuGE Navigator)
19862939 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19860911 Observational study of gene-disease association. (HuGE Navigator)
19819209 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19783684 association of Syk to IL-4R(alpha) is of biological significance and IL-4R(alpha) is a new candidate to be added to the few cytokine receptor components which associate with Syk.
19773451 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19773279 Observational study of gene-disease association. (HuGE Navigator)
19739012 The urinary soluble IL-4 receptor levels did not correlate with the clinical severity of vesicoureteral reflux
19729601 Observational study of gene-disease association. (HuGE Navigator)
19692168 Observational study of gene-disease association. (HuGE Navigator)
19683555 Observational study of gene-disease association. (HuGE Navigator)
19674346 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19657898 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19625176 Observational study of gene-disease association. (HuGE Navigator)
19594368 Observational study of genotype prevalence. (HuGE Navigator)
19590686 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19573080 Observational study of gene-disease association. (HuGE Navigator)
19559392 Observational study of gene-disease association. (HuGE Navigator)
19555572 Observational study of gene-disease association. (HuGE Navigator)
19548368 IL4Ralpha could be a candidate gene for assessing the risk of renal cell carcinoma.
19548368 Observational study of gene-disease association. (HuGE Navigator)
19544559 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19531027 Data show that IL-4 receptors are functionally competent in pancreatic beta-cells and that they signal via PI3K and JAK/STAT pathways.
19527514 Observational study of gene-disease association. (HuGE Navigator)
19515749 These data support the role for host germline gene variations of immunologically important factors like the IL4R I75V gene variation to predict the survival in diffuse large B-cell lymphoma patients.
19515749 Observational study of gene-disease association. (HuGE Navigator)
19508433 Observational study of gene-disease association. (HuGE Navigator)
19505916 Observational study of gene-disease association. (HuGE Navigator)
19479237 Observational study of gene-disease association. (HuGE Navigator)
19470040 Observational study of gene-disease association. (HuGE Navigator)
19447482 These results suggest that day care attendance is associated with serum IgE levels, and this effect is modified by CD14-550C/T and IL4R Ile50Val polymorphisms.
19421745 The IL4Ralpha Q576 allele is related to penicillin allergy, and the IL-4Ralpha I75 allele is associated with the symptom of urticaria. The Q576/I75 haplotype may be related with an allergy to penicillin.
19421745 Observational study of gene-disease association. (HuGE Navigator)
19420105 Observational study of gene-disease association. (HuGE Navigator)
19414811 IL4Ralpha is up-regulated in both myeloid populations but its presence correlates with an immunosuppressive phenotype only when mononuclear cells, but not granulocytes, of tumor-bearing patients are considered.
19408823 Observational study of genotype prevalence. (HuGE Navigator)
19382262 The present study for the first time suggests an association of IL-4Ralpha I50 allele with increased likelihood of HIV-1 infection in North Indian population.
19382262 Observational study of gene-disease association. (HuGE Navigator)
19332120 Observational study of gene-disease association. (HuGE Navigator)
19279357 IL4RA (1902/G:G) polymorphism was found to be positively (susceptible) associated with chronic obstructive pulmonary disease in Macedonians.
19264973 Observational study of gene-disease association. (HuGE Navigator)
19263529 Observational study of gene-disease association. (HuGE Navigator)
19258923 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19170196 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19131662 Meta-analysis of gene-disease association. (HuGE Navigator)
19117745 Observational study of gene-disease association. (HuGE Navigator)
19109239 IL-4 activates signaling pathways through type I IL-4Rs qualitatively differently from IL-13, which cooperate to induce optimal gene expression.
19074885 Observational study of gene-disease association. (HuGE Navigator)
19028820 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19019335 Observational study of gene-disease association. (HuGE Navigator)
19011907 Observational study of gene-disease association. (HuGE Navigator)
18974840 Observational study of gene-disease association. (HuGE Navigator)
18957266 data indicate inactivation of receptor-associated protein tyrosine phosphatase activity by cytokine-generated reactive oxygen species is a physiologic mechanism for amplification of IL-4 receptor activation revealing a role for ROS in cytokine crosstalk
18936436 Observational study of genotype prevalence. (HuGE Navigator)
18931892 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18927306 Polymorphisms in the interleukin-4 receptor gene are associated with better survival in patients with glioblastoma
18927306 Observational study of gene-disease association. (HuGE Navigator)
18849614 Single nucleotide polymorphisms of IL4RA are not associated with olive pollen allergy or asthma, but the interaction between IL4RA I50V/Q551R was strongly associated with the asthma phenotype.
18849614 Observational study of gene-disease association. (HuGE Navigator)
18818748 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18813073 Observational study of gene-disease association. (HuGE Navigator)
18809513 The urine evaluation of the balance between IFN-gammaR1 and IL4R receptors might be informative for the immune states of HUS patients.
18781131 Observational study of gene-disease association. (HuGE Navigator)
18774776 This study demonstrated upregulation of type 1 IL-4R by IFN-gamma, which resulted in enhanced IL-4-induced production of CCL26 from keratinocytes.
18773331 Observational study of gene-disease association. (HuGE Navigator)
18715339 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18691306 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18676680 Observational study of gene-disease association. (HuGE Navigator)
18674658 Observational study of gene-disease association. (HuGE Navigator)
18636124 Observational study of gene-disease association. (HuGE Navigator)
18633131 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18632425 Observational study of genotype prevalence. (HuGE Navigator)
18628242 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18625055 There is a lack of association or interactions between the IL-4, IL-4Ralpha and IL-13 genes, and rheumatoid arthritis.
18625055 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18610832 Observational study of gene-disease association. (HuGE Navigator)
18610831 Observational study of gene-disease association. (HuGE Navigator)
18576348 our data indicate that the AA genotype of the IL4R 150V SNP is associated with joint erosions in psoriatic arthritis
18576348 Observational study of gene-disease association. (HuGE Navigator)
18547691 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18538381 Observational study of gene-disease association. (HuGE Navigator)
18448485 Observational study of gene-disease association. (HuGE Navigator)
18433792 Analyses of genotype distributions and allele frequencies of study subjects revealed that rs 180275 polymorphism in IL4R was associated with an increase in BMI in Korean population.
18433792 Observational study of gene-disease association. (HuGE Navigator)
18425216 Observational study of gene-disease association. (HuGE Navigator)
18389618 Observational study of gene-disease association. (HuGE Navigator)
18263811 combined polymorphisms in the IL-13/IL-4R signaling pathway were associated with SJS/TEN with ocular surface complications.
18263811 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18179773 IL-4 and IL-4RA gene polymorphisms concur in selecting the H. pylori infecting strain, probably influencing the IL-4 signalling pathway
18179773 Observational study of gene-disease association. (HuGE Navigator)
18095154 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18031948 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18031948 we studied the association of variants in IL-4 (C-589T, G3017T) and IL-4R alpha (Gln576Arg) with allergies and with risk of pancreatic cancer
18006935 Observational study of gene-disease association. (HuGE Navigator)
17988330 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17988330 The IL-4R Ile50/Ile50 and IL-10R2 G520/G520 and G520/A520 genotypes were shown to determine the susceptibility to SLE(systemic lupus erythematosus)in a Chinese population
17901851 IL-4R overexpression on newborns' monocytes and lymphocytes could be an early risk marker of allergy development.
17900677 analysis of polymorphisms of Ile50Val (rs.1805010), Ser478Pro (rs.1805015), and Gln551Arg (rs.1801275) in the IL4R gene between Japanese patients with Stevens-Johnson syndrome and Japanese healthy volunteers
17889143 Observational study of gene-disease association. (HuGE Navigator)
17823973 Observational study of gene-disease association. (HuGE Navigator)
17823973 IL4R gene polymorphisms may have roles in asthma in Chinese populations
17714919 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17703412 Observational study of gene-disease association. (HuGE Navigator)
17688234 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17688234 The IL-4R 75V variant was associated with increased risk of cervical tumors, cases homozygote for 75V had an odds ratio of 1.91 (1.27-2.86) with a tendency that the association was stronger in noncarriers of the DQB1*0602 allele.
17627763 Observational study of genotype prevalence. (HuGE Navigator)
17600229 Observational study of gene-disease association. (HuGE Navigator)
17586032 Meta-analysis of gene-disease association. (HuGE Navigator)
17586032 A meta-analysis of results from case-control studies strongly supports the conclusion that the R551 IL4R variant imparts a modest yet significant risk for atopic asthma
17548690 Observational study of gene-disease association. (HuGE Navigator)
17548690 IL4 and IL4R polymorphisms and haplotypes were neither significantly associated with IgE levels in controls nor associated with glioma status
17536219 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17523428 Observational study of gene-disease association. (HuGE Navigator)
17444864 Observational study of gene-disease association. (HuGE Navigator)
17420820 Observational study of gene-disease association. (HuGE Navigator)
17420820 IL4+33 and IL4R*Q551 polymorphisms may have a promoting role of TH2 mediators in African MS descendants. IL4 and IL4R genes are susceptibility factors for Brazilian MS but may be able to modify ethnicity-dependent disease risk and penetrance.
17362266 Observational study of gene-disease association. (HuGE Navigator)
17315188 Observational study of gene-disease association. (HuGE Navigator)
17303794 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17291854 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17284225 Observational study of gene-disease association. (HuGE Navigator)
17258448 Observational study of gene-disease association. (HuGE Navigator)
17257312 Observational study of genotype prevalence. (HuGE Navigator)
17209513 Observational study of gene-disease association. (HuGE Navigator)
17201240 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
17179726 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17170387 Observational study of gene-disease association. (HuGE Navigator)
17170387 SNPs in IL4Ralpha, which are more common in African Americans, are associated with severe asthma exacerbations, lower lung function, and increased mast cell-related tissue inflammation
17152005 Observational study of gene-disease association. (HuGE Navigator)
17143971 Observational study of gene-disease association. (HuGE Navigator)
17143971 Our findings of higher frequency of IL4 and IL4RA genotypes and alleles with rheumatoid arthritis.
17121586 Observational study of gene-disease association. (HuGE Navigator)
17115186 Observational study of gene-disease association. (HuGE Navigator)
17091279 Observational study of gene-disease association. (HuGE Navigator)
17083349 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17083349 Variants in the IL4RA gene alone may not exert any major influence on susceptibility to asthma-related diseases in childhood, but in combination with other genes, such as IL9R, IL4RA may be an important gene for disease susceptibility
17045041 The Ile50Val polymorphism of IL-4R alpha gene is not associated with bronchial asthma in Han nationality patients.
17045041 Observational study of gene-disease association. (HuGE Navigator)
17006724 Observational study of gene-disease association. (HuGE Navigator)
17006724 Homozygotes with the low activity allele of the A398G polymorphism in the IL4R gene had a modest increase in risk of atrophic gastritis (OR = 1.52, 95% CI: 1.05-2.21), compared with homozygotes of the high activity allele.
17001290 Observational study of gene-disease association, gene-gene interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16961803 Observational study of gene-disease association. (HuGE Navigator)
16950281 Observational study of gene-disease association. (HuGE Navigator)
16938461 Observational study of gene-disease association. (HuGE Navigator)
16917945 Results show sequence variations as a possible way of altering alternative splicing selection of IL4R in vivo.
16914241 Observational study of gene-disease association. (HuGE Navigator)
16867043 Observational study of gene-disease association. (HuGE Navigator)
16842617 Observational study of gene-disease association. (HuGE Navigator)
16757160 Observational study of gene-disease association. (HuGE Navigator)
16750991 Observational study of gene-disease association. (HuGE Navigator)
16699452 Observational study of gene-disease association. (HuGE Navigator)
16681592 Observational study of gene-disease association. (HuGE Navigator)
16646030 Observational study of gene-disease association. (HuGE Navigator)
16640778 A structure/function analysis of the IL-4 ligand-receptor interaction, using various mutations of both the ligand and the receptor, is reported.
16625214 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16625214 Multifactor dimensionality reduction (MDR) test was applied to detect epistasis, and identified single-IL4R(Q576R)- and three-IL4R(Q576R), IL5RA(-80), CD14(-260)- locus association models that predict multiple sclerosis risk with 75-76% accuracy.
16613701 Observational study of gene-disease association. (HuGE Navigator)
16600026 Observational study of gene-disease association. (HuGE Navigator)
16551465 Observational study of gene-disease association. (HuGE Navigator)
16551465 This is the first demonstration of sex-specific association of the two foremost genes of the IL-4 signalling cascade with chronic inflammatory arthropathies.
16538488 Observational study of gene-disease association. (HuGE Navigator)
16538488 No association between type 1 diabetes and any SNP or haplotype was found by the transmission disequilibrium test.
16503977 Observational study of gene-disease association. (HuGE Navigator)
16403098 Observational study of gene-disease association. (HuGE Navigator)
16387595 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16313681 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16313303 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16280132 Observational study of gene-disease association. (HuGE Navigator)
16264039 In conclusion, these results suggest that viral airway infection may enhance interleukin-4-induced eotaxin-3 production through upregulation of the interleukin-4 receptor in airway epithelial cells.
16226465 The soluble receptor balance (sIL-2R/sIL-4R) in patients with severe hemolytic uremic syndrome may shift, depending on the disease state of the patients
16189667 Observational study of gene-disease association. (HuGE Navigator)
16189667 IL$R alpha V50 homozygosity associates with slow progression and that exon 12 U-haplotypes might be associated with both susceptibility to infection via parenteral route and resistance to infection via sexual exposure.
16184405 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16100774 Observational study of genotype prevalence. (HuGE Navigator)
16046318 Observational study of gene-disease association. (HuGE Navigator)
16024651 Observational study of gene-disease association. (HuGE Navigator)
15981567 Observational study of gene-disease association. (HuGE Navigator)
15969687 The IL-4RalphaQ576R polymorphism may involve in the development of penicillins allergy, and through modulating specific serum IgE levels.
15842262 Observational study of gene-disease association. (HuGE Navigator)
15737301 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
15733644 Observational study of gene-disease association. (HuGE Navigator)
15712015 Observational study of gene-disease association. (HuGE Navigator)
15660293 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
15566952 Observational study of gene-disease association. (HuGE Navigator)
15564773 Observational study of genotype prevalence and gene-disease association. (HuGE Navigator)
15521376 differences in the potency of IL-13- and IL-4-mediated induction of eotaxin-3 might be explained by expression of types 1 and 2 IL-4 receptors in bronchial epithelium
15497451 Observational study of gene-disease association. (HuGE Navigator)
15497451 Polymorphisms of IL-4R previously associated with other immune mediated diseases, do not confer susceptibility to Graves' disease in white Caucasians in the United Kingdom.
15479272 Observational study of gene-disease association. (HuGE Navigator)
15367225 Observational study of gene-disease association. (HuGE Navigator)
15361128 Observational study of genotype prevalence. (HuGE Navigator)
15356556 V50R551 IL-4R alpha variant has enhanced function alone, but with Q110 IL-13 variant the 2 have a synergistic effect on IL-13-dependent gene induction.
15298559 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
15194285 Observational study of gene-disease association. (HuGE Navigator)
15170937 Observational study of gene-disease association. (HuGE Navigator)
15161635 Certain interstitial pneumonia patients can be modulated in a manner that is dependent on the IL-4 and IL-13 receptor subunit expression by these cells.
15122773 Observational study of gene-disease association. (HuGE Navigator)
15057902 Observational study of gene-disease association. (HuGE Navigator)
15021309 Observational study of gene-disease association. (HuGE Navigator)
15007352 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
15007352 variants in the IL4, IL13, and IL4RA genes play an important role in controlling specific IgE response in atopy
15007345 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
15007345 polymorphisms of IL1A (G/T at +4845) and IL4RA (T/C at +22446) show an epistatic effect on the risk of atopy
15005726 Observational study of gene-disease association. (HuGE Navigator)
14984008 Observational study of gene-disease association. (HuGE Navigator)
14984008 investigated the frequency and genotypes of S503P and Q576R SNPs and their association with traits of allergic asthma in a Hawaii population
14745651 Observational study of gene-disease association. (HuGE Navigator)
14745651 functional variants within the IL4R gene predispose to hip osteoarthritis in Caucasian females
14615367 Observational study of gene-disease association. (HuGE Navigator)
14523823 Observational study of gene-disease association. (HuGE Navigator)
14523823 The prevalence of the mutant variant of the IL-4ra gene was lower in neonates with necrotizing enterocolitis (NEC) compared with those without NEC, suggesting that this mutation might protect against the development of NEC in VLBW infants.
12973929 Observational study of gene-disease association. (HuGE Navigator)
12940513 Observational study of gene-disease association. (HuGE Navigator)
12940513 IL-4R alpha chain 576R/R genotypes confer genetic susceptibility to allergic asthma in Chinese.
12900808 Observational study of gene-disease association. (HuGE Navigator)
12897746 Observational study of gene-disease association. (HuGE Navigator)
12897746 No genotypic effects on total serum IgE levels.
12871855 Th2 cytokines enhance TARC expression in human airway smooth muscle cells in IL-4Ralpha genotype-dependent fashion.
12753568 Observational study of gene-disease association. (HuGE Navigator)
12748907 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
12748907 IL4R is associated with diabetes mellitus, type 1 in Filipinos.
12743452 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
12594065 Observational study of gene-disease association. (HuGE Navigator)
12594065 Allele frequency of IL4RA polymorphism was associated with rapid decline of lung function in smokers.
12558814 Observational study of genotype prevalence. (HuGE Navigator)
12508140 Observational study of gene-disease association. (HuGE Navigator)
12459556 role of Tyr-713 in the interleukin-4 receptor alpha in regulating dephosphorylation of Stat6
12454749 up-regulated 5-fold in B cell chronic lymphocytic leukemia cells, probably leading to increased responsiveness to IL4 and resistance to apoptosis
12442007 Observational study of gene-disease association. (HuGE Navigator)
12422339 Observational study of gene-disease association. (HuGE Navigator)
12420205 Observational study of gene-disease association. (HuGE Navigator)
12401728 association of haplotype with type 1 diabetes
12171893 Observational study of gene-disease association. (HuGE Navigator)
12133990 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
12115161 Observational study of gene-disease association. (HuGE Navigator)
12100043 Observational study of gene-disease association. (HuGE Navigator)
12082592 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
12047365 no evidence for linkage of the IL4R gene locus with sarcoidosis
12047364 a single gene effect of IL4Ralpha variants or any other gene on chromosome 16 could not be shown in a selected population of children with asthma
12020266 Observational study of gene-disease association. (HuGE Navigator)
11991671 Endogenous interferon-alpha production by differentiating human monocytes regulates expression and function of the IL-2/IL-4 receptor gamma chain
11922633 Observational study of gene-disease association. (HuGE Navigator)
11922633 These results suggest TXA2 receptor polymorphism strongly interacts with IL-4R alpha polymorphism as a major determinant of high serum immunoglobulin E levels in atopic dermatitis.
11811777 Characterization of IL-4 receptor components expressed on monocytes and monocyte-derived macrophages: variation associated with differential signaling by IL-4
11801567 internalization of interleukin 4 receptor alpha increases cytotoxic effect of interleukin 4-receptor-targeted cytotoxin in cancer cells.
11786020 high-affinity interaction of human IL-4 and the receptor alpha chain is constituted by two independent binding clusters
11714803 Tyrosine-phosphorylated IL4R peptides coprecipitate SH2-containing tyrosine phosphatase-1, SH2-containing tyrosine phosphatase-2, and SH2-containing inositol 5'-phosphatase, demonstrating a regulatory role for the ITIM motif in IL-4-induced proliferation.
11709756 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
11709756 gene-gene interaction in asthma: IL4RA and IL13 in a Dutch population with asthma
11678851 Observational study of gene-disease association. (HuGE Navigator)
11544427 Observational study of gene-disease association. (HuGE Navigator)
11528525 Observational study of gene-disease association. (HuGE Navigator)
11491529 Observational study of gene-disease association. (HuGE Navigator)
11354638 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
11233912 Observational study of gene-disease association. (HuGE Navigator)
11164908 Observational study of gene-disease association. (HuGE Navigator)
11035134 Observational study of gene-disease association. (HuGE Navigator)
8891114 HIV-1 Tat upregulates IL-4R in the Raji B-lymphoblastoid cell line, suggesting the possibility that the immunosuppressive effects of HIV-1 are mediated at least in part through IL-4 receptors
1617647 HIV-1 Tat upregulates IL-4R in the Raji B-lymphoblastoid cell line, suggesting the possibility that the immunosuppressive effects of HIV-1 are mediated at least in part through IL-4 receptors

AA Sequence

MGWLCSGLLFPVSCLVLLQVASSGNMKVLQEPTCVSDYMSISTCEWKMNGPTNCSTELRLLYQLVFLLSE      1 - 70
AHTCIPENNGGAGCVCHLLMDDVVSADNYTLDLWAGQQLLWKGSFKPSEHVKPRAPGNLTVHTNVSDTLL     71 - 140
LTWSNPYPPDNYLYNHLTYAVNIWSENDPADFRIYNVTYLEPSLRIAASTLKSGISYRARVRAWAQCYNT    141 - 210
TWSEWSPSTKWHNSYREPFEQHLLLGVSVSCIVILAVCLLCYVSITKIKKEWWDQIPNPARSRLVAIIIQ    211 - 280
DAQGSQWEKRSRGQEPAKCPHWKNCLTKLLPCFLEHNMKRDEDPHKAAKEMPFQGSGKSAWCPVEISKTV    281 - 350
LWPESISVVRCVELFEAPVECEEEEEVEEEKGSFCASPESSRDDFQEGREGIVARLTESLFLDLLGEENG    351 - 420
GFCQQDMGESCLLPPSGSTSAHMPWDEFPSAGPKEAPPWGKEQPLHLEPSPPASPTQSPDNLTCTETPLV    421 - 490
IAGNPAYRSFSNSLSQSPCPRELGPDPLLARHLEEVEPEMPCVPQLSEPTTVPQPEPETWEQILRRNVLQ    491 - 560
HGAAAAPVSAPTSGYQEFVHAVEQGGTQASAVVGLGPPGEAGYKAFSSLLASSAVSPEKCGFGASSGEEG    561 - 630
YKPFQDLIPGCPGDPAPVPVPLFTFGLDREPPRSPQSSHLPSSSPEHLGLEPGEKVEDMPKPPLPQEQAT    631 - 700
DPLVDSLGSGIVYSALTCHLCGHLKQCHGQEDGGQTPVMASPCCGCCCGDRSSPPTTPLRAPDPSPGGVP    701 - 770
LEASLCPASLAPSGISEKSKSSSSFHPAPGNAQSSSQTPKIVNFVSVGPTYMRVS                   771 - 825
//

Text Mined References (404)

PMID Year Title
26831416 2015 A preliminary study on the association of single nucleotide polymorphisms of interleukin 4 (IL4), IL13, IL4 receptor alpha (IL4R?) & Toll-like receptor 4 (TLR4) genes with asthma in Indian adults.
26695670 2015 [Correlations of IL-4R gene polymorphism and serum IgE levels with asthma predictive index].
26693492 2015 Autoimmune Hepatitis in Brazilian Children: IgE and Genetic Polymorphisms in Associated Genes.
26667837 2015 Polymorphisms in Host Immunity-Modulating Genes and Risk of Invasive Aspergillosis: Results from the AspBIOmics Consortium.
26437765 2015 Angiogenesis related genes NOS3, CD14, MMP3 and IL4R are associated to VEGF gene expression and circulating levels in healthy adults.
26306492 2015 Essential role of endocytosis for interleukin-4-receptor-mediated JAK/STAT signalling.
26281177 2015 [IMMUNOGENETICS AND PROGRESSION OF CHRONIC VIRAL HEPATITES].
26187331 2015 Commentary: IL-4 and IL-13 receptors and signaling.
26088753 2015 Targeting of IL-4 and IL-13 receptors for cancer therapy.
25867440 2015 Association of the IL-4R Q576R polymorphism and asthma in the Chinese Han population: a meta-analysis.
25769611 2015 Regulatory T cell reprogramming toward a Th2-cell-like lineage impairs oral tolerance and promotes food allergy.
25746764 2015 IL4 receptor ? mediates enhanced glucose and glutamine metabolism to support breast cancer growth.
25483786 2015 Recurrence and cancer-specific survival according to the expression of IL-4R? and IL-13R?1 in patients with oral cavity cancer.
25468331 2014 Dynamics and interaction of interleukin-4 receptor subunits in living cells.
25252624 2014 Variations in the TNF? gene and their interactions with the IL4R and IL10 genes in relation to hand osteoarthritis.
25170298 2014 Impact of single nucleotide polymorphism in IL-4, IL-4R genes and systemic concentration of IL-4 on the incidence of glioma in Iraqi patients.
25110223 rs1801275 Interleukin-4 receptor alpha polymorphism in familial hypercholesterolemia.
24975796 2014 Genome-wide expression profiling of B lymphocytes reveals IL4R increase in allergic asthma.
24960198 2014 IL-4 receptor ? in non-lipid rafts is the target molecule of strictinin in inhibiting STAT6 activation.
24803421 2014 Association of the IL4R single-nucleotide polymorphism I50V with recurrent spontaneous abortion (RSA).
24782180 2014 Increased Th17 cell frequency and poor clinical outcome in rheumatoid arthritis are associated with a genetic variant in the IL4R gene, rs1805010.
24742632 2014 Association between genes encoding components of the IL-4/IL-4 receptor pathway and dermatitis in children.
24510574 2014 [Association study of bronchial asthma with polymorphisms of IL-4 and IL-4R receptor genes].
24386991 2014 Role of beta-defensin 2 and interleukin-4 receptor as stroke outcome biomarkers.
24339977 2013 Construction and application of elastin like polypeptide containing IL-4 receptor targeting peptide.
24185116 2014 Higher TGF-? with lower CD124 and TSLP, but no difference in PAR-2 expression in bronchial biopsy of bronchial asthma patients in comparison with COPD patients.
24056919 2013 The association of the cytoplasmic domains of interleukin 4 receptor alpha and interleukin 13 receptor alpha 2 regulates interleukin 4 signaling.
23983153 2013 Association of genetic variants in the IL4 and IL4R genes with the severity of joint damage in rheumatoid arthritis: a study in seven cohorts.
23979976 2014 Association of the interleukin-4R? rs1801275 and rs1805015 polymorphisms with glioma risk.
23972290 2013 Associations of interleukin-4 receptor gene polymorphisms (Q551R, I50V) with rheumatoid arthritis: evidence from a meta-analysis.
23924473 2013 Association between the polymorphisms of interleukin-4, the interleukin-4 receptor gene and asthma.
23922687 2013 Association between interleukin-4 receptor ? chain (IL4RA) I50V and Q551R polymorphisms and asthma risk: an update meta-analysis.
23883285 2013 Interleukin-4, interleukin-4 receptor, and interleukin-18 polymorphisms and rheumatoid arthritis: a meta-analysis.
23817569 2013 A genome-wide association meta-analysis of self-reported allergy identifies shared and allergy-specific susceptibility loci.
23784081 2013 Reduced type II interleukin-4 receptor signalling drives initiation, but not progression, of colorectal carcinogenesis: evidence from transgenic mouse models and human case-control epidemiological observations.
23774696 Interleukin-4 (-590 C>T) and interleukin-4 receptor (Q551R A>G) gene polymorphisms in Saudi patients with vitiligo.
23663500 2013 Genetic association between selected cytokine genes and glioblastoma in the Han Chinese population.
23597562 2013 Inhibition of tumor angiogenesis and growth by a small-molecule multi-FGF receptor blocker with allosteric properties.
23557074 2014 Interleukin-4RA gene polymorphism is associated with oral mucous membrane pemphigoid.
23543769 2013 IL-4R? on CD4+ T cells plays a pathogenic role in respiratory syncytial virus reinfection in mice infected initially as neonates.
23527710 TNF-alpha, IL-4R-alpha and IL-4 polymorphisms in mild to severe asthma from Italian Caucasians.
23525950 2013 Single-nucleotide polymorphisms of allergy-related genes and risk of adult glioma.
23480403 2013 Case-control study of eczema in relation to IL4R? genetic polymorphisms in Japanese women: The Kyushu Okinawa Maternal and Child Health Study.
23395224 2013 Association between polymorphisms in interleukin-4R? and interleukin-13 and glioma risk: a meta-analysis.
23383283 2013 Reduced interleukin-4 receptor ? expression on CD8+ T cells correlates with higher quality anti-viral immunity.
23382219 2013 Structural basis for endosomal trafficking of diverse transmembrane cargos by PX-FERM proteins.
23376457 2013 Cytokine gene polymorphisms in Tunisian endemic pemphigus foliaceus: a possible role of il-4 variants.
23217179 2012 IL1B, IL4R, IL12RB1 and TNF gene polymorphisms are associated with Plasmodium vivax malaria in Brazil.
23066418 2012 Changes in plasma IL4, TNFá and CRP in response to regular passive smoking at home among healthy school children in Khartoum, Sudan.
22997428 2012 Identification of new autoantigens by protein array indicates a role for IL4 neutralization in autoimmune hepatitis.
22902050 2012 Using haplotype analysis to elucidate significant associations between genes and Hodgkin lymphoma.
22891178 2012 Interleukin-4 receptor -3223T→C polymorphism is associated with increased gastric adenocarcinoma risk.
22764749 2012 Biological and genetic determinants of atopy are predictors of immediate-type allergy to betalactams, in Spain.
22705603 Association of interleukin 4 (-590 T/C) and interleukin 4 receptor (Q551R A/G) gene polymorphisms with acne vulgaris.
22633285 2012 Association of IL-4 receptor gene polymorphisms with high density lipoprotein cholesterol.
22541248 2012 IL-4 receptor polymorphisms predict reduction in asthma exacerbations during response to an anti-IL-4 receptor ? antagonist.
22484276 2012 Effects of cytokine and cytokine receptor gene variation on high anti-HB titers: following up on Taiwan's neonatal hepatitis B immunization program.
22441356 2012 Expression of interleukin-4 and interleukin-13 and their receptors in colorectal cancer.
22376040 2012 Gene-gene interactions between candidate gene polymorphisms are associated with total IgE levels in Korean children with asthma.
22369735 2012 Polymorphisms of TREH, IL4R and CCDC26 genes associated with risk of glioma.
22355322 2012 Gene-gene and gene-environmental interactions of childhood asthma: a multifactor dimension reduction approach.
22317767 2012 Polymorphisms in the IL-13 and IL-4R genes are associated with the development of renal cell carcinoma.
22261806 2012 Expression of interleukin-4 receptor alpha in human pleural mesothelioma is associated with poor survival and promotion of tumor inflammation.
22170601 2012 The polymorphisms of IL-4, IL-4R and IL-13 genes and bladder cancer risk in a Chinese population: a case-control study.
22119518 2012 Interleukin-4 receptor alpha polymorphisms in autoimmune myasthenia gravis in a Caucasian population.
22098734 2011 Single cell analysis of ligand binding and complex formation of interleukin-4 receptor subunits.
22087298 2011 Association study on IL4, IL13 and IL4RA polymorphisms in mite-sensitized persistent allergic rhinitis in a Chinese population.
22075330 2012 A genome-wide association study of plasma total IgE concentrations in the Framingham Heart Study.
22059556 2011 Asthma-related SNP in FCER2 is associated with increased expression of IL-4R on human B cells.
22045834 2012 Polymorphisms in the interleukin 4, interleukin 13, and corresponding receptor genes are not associated with systemic sclerosis and do not influence gene expression.
21918367 2012 The differences in the involvements of loci of promoter region and Ile50Val in interleukin-4 receptor ? chain gene between atopic dermatitis and Japanese cedar pollinosis.
21913997 2011 Association of polymorphisms in genes encoding IL-4, IL-13 and their receptors with atopic dermatitis in a Korean population.
21734400 2011 Attempted replication of 50 reported asthma risk genes identifies a SNP in RAD50 as associated with childhood atopic asthma.
21733492 2011 The genetic impact of the Q551R interleukin-4 receptor alpha polymorphism for aggressive or chronic periodontitis and the occurrence of periodontopathic bacteria.
21729106 2011 Interleukin 4, interleukin 4 receptor-? and interleukin 10 gene polymorphisms in Chagas disease.
21536546 2011 IL-4R drives dedifferentiation, mitogenesis, and metastasis in rhabdomyosarcoma.
21497535 2012 Association of interleukin-4 receptor gene polymorphisms with rheumatoid arthritis in Egyptian female patients.
21489615 2011 Hexamethylene diisocyanate asthma is associated with genetic polymorphisms of CD14, IL-13, and IL-4 receptor ?.
21251883 2011 CCL2, CCL18 and sIL-4R in renal, meningeal and pulmonary TB; a 2 year study of patients and contacts.
21211370 2010 [Meta-analysis on interleukin-4 receptor ? chain Q576R gene polymorphisms and bronchial asthma susceptibility].
21071541 2011 Risk of cervical cancer associated with allergies and polymorphisms in genes in the chromosome 5 cytokine cluster.
21070662 2010 Schizophrenia and vitamin D related genes could have been subject to latitude-driven adaptation.
21061265 2011 Hodgkin disease risk: role of genetic polymorphisms and gene-gene interactions in inflammation pathway genes.
21054877 2010 Inflammation gene variants and susceptibility to albuminuria in the U.S. population: analysis in the Third National Health and Nutrition Examination Survey (NHANES III), 1991-1994.
20811626 2010 Genetic variants in inflammation-related genes are associated with radiation-induced toxicity following treatment for non-small cell lung cancer.
20729386 2010 Expression of IL-4/IL-13 receptors in differentiating human airway epithelial cells.
20716621 2010 Genetic polymorphisms in adaptive immunity genes and childhood acute lymphoblastic leukemia.
20703737 2012 The association forecasting of 13 variants within seven asthma susceptibility genes on 3 serum IgE groups in Taiwanese population by integrating of adaptive neuro-fuzzy inference system (ANFIS) and classification analysis methods.
20673868 2010 A genetic association study of maternal and fetal candidate genes that predispose to preterm prelabor rupture of membranes (PROM).
20654748 2010 High-density polymorphisms analysis of 23 candidate genes for association with bone mineral density.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20603050 2010 A 3-factor epistatic model predicts digital ulcers in Italian scleroderma patients.
20603037 2010 Single nucleotide polymorphisms in inflammation-related genes are associated with venous thromboembolism.
20568250 2010 Common single nucleotide polymorphisms in immunoregulatory genes and multiple myeloma risk among women in Connecticut.
20536507 2010 Independent predictive roles of eotaxin Ala23Thr, paraoxonase 2 Ser311Cys and beta-adrenergic receptor Trp64Arg polymorphisms on cardiac disease in Type 2 Diabetes--an 8-year prospective cohort analysis of 1297 patients.
20517665 2010 Association of Q551R polymorphism in the interleukin 4 receptor gene with nonatopic asthma in Slovenian children.
20503287 2010 Interleukin-9 polymorphism in infants with respiratory syncytial virus infection: an opposite effect in boys and girls.
20484924 2010 Interleukin 13 and interleukin 4 receptor-? polymorphisms in rhinitis and asthma.
20459687 2010 Candidate malaria susceptibility/protective SNPs in hospital and population-based studies: the effect of sub-structuring.
20453000 2010 A Large-scale genetic association study of esophageal adenocarcinoma risk.
20452482 2010 Identification of fetal and maternal single nucleotide polymorphisms in candidate genes that predispose to spontaneous preterm labor with intact membranes.
20444266 2010 Association of IL4R single-nucleotide polymorphisms with rheumatoid nodules in African Americans with rheumatoid arthritis.
20424473 2010 L-type voltage-dependent calcium channel alpha subunit 1C is a novel candidate gene associated with secondary hyperparathyroidism: an application of haplotype-based analysis for multiple linked single nucleotide polymorphisms.
20417488 2010 Association of fetal inflammation and coagulation pathway gene polymorphisms with neurodevelopmental delay at age 2 years.
20416077 2010 Identification of type 2 diabetes-associated combination of SNPs using support vector machine.
20394509 2010 Association and gene-gene interactions of eight common single-nucleotide polymorphisms with pediatric asthma in middle china.
20378664 2010 Analysis of multiple candidate genes in association with phenotypes of multiple sclerosis.
20299965 2010 Cytokine signaling pathway polymorphisms and AIDS-related non-Hodgkin lymphoma risk in the multicenter AIDS cohort study.
20298583 2010 Association of IL-4RA single nucleotide polymorphisms, HLA-DR and HLA-DQ in children with Alternaria-sensitive moderate-severe asthma.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20219689 2010 Interleukin-4/interleukin-4 receptor gene polymorphisms in hand osteoarthritis.
20213229 2010 Cytokine polymorphisms and Alzheimer disease: possible associations.
20176658 2010 Epithelial interleukin-4 receptor expression promotes colon tumor growth.
20163933 2010 Polymorphisms of genes encoding tumor necrosis factor-alpha, interleukin-10, cluster of differentiation-14 and interleukin-1ra in critically ill patients.
20140262 2010 Maternal and fetal genetic associations of PTGER3 and PON1 with preterm birth.
20128416 2009 Polymorphisms in IL4 and iLARA confer susceptibility to asthma.
20085599 2009 A multi-centre study of candidate genes for wheeze and allergy: the International Study of Asthma and Allergies in Childhood Phase 2.
20072140 2010 RGMA and IL21R show association with experimental inflammation and multiple sclerosis.
20040389 2010 Flavones suppress type I IL-4 receptor signaling by down-regulating the expression of common gamma chain.
20002627 2010 Interleukin-4 receptor polymorphisms in asthma and allergy: relation to different disease phenotypes.
19956098 2009 Association analysis of SNPs in the IL4R locus with type I diabetes.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19863607 2010 Association between interleukin-4R and TGF-?1 gene polymorphisms and the risk of colorectal cancer in a Korean population.
19862939 2009 Single-nucleotide polymorphisms in genes predisposing to asthma in children of Chinese Han nationality.
19860911 2009 Variation in cytokine genes can contribute to severity of acetabular osteolysis and risk for revision in patients with ABG 1 total hip arthroplasty: a genetic association study.
19819209 2009 Influence of cytokine gene variations on immunization to childhood vaccines.
19783684 2009 IL-4R(alpha), a new member that associates with Syk kinase: implication in IL-4-induced human neutrophil functions.
19773451 2009 Role of inflammation gene polymorphisms on pain severity in lung cancer patients.
19773279 2009 Association between genetic variants in VEGF, ERCC3 and occupational benzene haematotoxicity.
19739012 2009 Urinary evaluation of the balance between the soluble interferon-gamma receptor (IFN-gammaR1) and the interleukin-4 receptor (IL-4Ralpha) in children with vesicoureteral reflux.
19729601 2009 Candidate gene polymorphisms for ischemic stroke.
19692168 2010 Genetic susceptibility to distinct bladder cancer subphenotypes.
19683555 2009 Role of human leukocyte antigen, killer-cell immunoglobulin-like receptors, and cytokine gene polymorphisms in leptospirosis.
19674346 2009 Polymorphisms in inflammation genes, tobacco smoke and furred pets and wheeze in children.
19657898 2009 Association of five single nucleotide polymorphism loci with asthma in children of Chinese Han nationality.
19641626 2009 Local network topology in human protein interaction data predicts functional association.
19625176 2009 PTEN identified as important risk factor of chronic obstructive pulmonary disease.
19594368 2009 Distribution of cytokine gene polymorphisms in the general Lebanese population: the first report.
19590686 2009 Postural changes in blood pressure associated with interactions between candidate genes for chronic respiratory diseases and exposure to particulate matter.
19573080 2009 Common genetic variants in candidate genes and risk of familial lymphoid malignancies.
19559392 2009 A candidate gene association study of 77 polymorphisms in migraine.
19555572 2009 [Single nucleotide polymorphism in asthma predisposing genes in children in Shanghai].
19548368 Interleukin-4-receptor alpha gene polymorphism and the risk of renal cell carcinoma in a South Indian population.
19544559 2009 Synergistic effect of HLA class II loci and cytokine gene polymorphisms on the risk of gastric cancer in Japanese patients with Helicobacter pylori infection.
19531027 2009 Human and rodent pancreatic beta-cells express IL-4 receptors and IL-4 protects against beta-cell apoptosis by activation of the PI3K and JAK/STAT pathways.
19527514 2009 Racial disparity in pathophysiologic pathways of preterm birth based on genetic variants.
19515749 2009 Favorable impact of the interleukin-4 receptor allelic variant I75 on the survival of diffuse large B-cell lymphoma patients demonstrated in a large prospective clinical trial.
19508433 2009 Genetic variants in immunoregulatory genes and risk for childhood lymphomas.
19505916 2009 Cytokine and cytokine receptor single-nucleotide polymorphisms predict risk for non-small cell lung cancer among women.
19479237 2009 Phenotype-genotype interactions on renal function in type 2 diabetes: an analysis using structural equation modelling.
19470040 2010 TNF-alpha and IL-10 gene polymorphisms show a weak association with pemphigus vulgaris in the Slovak population.
19447482 2009 CD14 and IL4R gene polymorphisms modify the effect of day care attendance on serum IgE levels.
19421745 2009 Polymorphisms and haplotype analysis of IL-4Ralpha Q576R and I75V in patients with penicillin allergy.
19420105 2009 A candidate gene approach to genetic prognostic factors of IgA nephropathy--a result of Polymorphism REsearch to DIstinguish genetic factors Contributing To progression of IgA Nephropathy (PREDICT-IgAN).
19414811 2009 IL4Ralpha+ myeloid-derived suppressor cell expansion in cancer patients.
19408823 2009 Distribution of the 22 cytokine gene polymorphisms in healthy Macedonian population.
19382262 2009 Association of IL-4 589 C/T promoter and IL-4RalphaI50V receptor polymorphism with susceptibility to HIV-1 infection in North Indians.
19332120 2009 Effect of desensitization in solid organ transplant recipients depends on some cytokines genes polymorphism.
19279357 2009 Association of cytokine gene polymorphisms with chronic obstructive pulmonary disease in Macedonians.
19264973 2009 Assessing the reproducibility of asthma candidate gene associations, using genome-wide data.
19263529 2009 Genetic risk factors in recurrent venous thromboembolism: A multilocus, population-based, prospective approach.
19258923 2009 Genetic susceptibility to respiratory syncytial virus bronchiolitis in preterm children is associated with airway remodeling genes and innate immune genes.
19170196 2009 Polymorphisms in innate immunity genes and lung cancer risk in Xuanwei, China.
19131662 2009 A meta-analysis of candidate gene polymorphisms and ischemic stroke in 6 study populations: association of lymphotoxin-alpha in nonhypertensive patients.
19117745 2009 Cytokine gene polymorphisms and BALF cytokine levels in interstitial lung diseases.
19109239 2008 Type I IL-4Rs selectively activate IRS-2 to induce target gene expression in macrophages.
19074885 2008 Genetic variants in apoptosis and immunoregulation-related genes are associated with risk of chronic lymphocytic leukemia.
19028820 2009 Polymorphisms in inflammatory genes and the risk of ischemic stroke and transient ischemic attack: results of a multilocus genotyping assay.
19019335 2009 Spontaneous preterm birth in African Americans is associated with infection and inflammatory response gene variants.
19011907 2009 Polymorphisms in interleukin-4-related genes in patients with minimal change nephrotic syndrome.
18974840 2008 Identification of novel single nucleotide polymorphisms in inflammatory genes as risk factors associated with trachomatous trichiasis.
18957266 2008 Redox regulation of interleukin-4 signaling.
18936436 2009 Prevalence in the United States of selected candidate gene variants: Third National Health and Nutrition Examination Survey, 1991-1994.
18931892 2009 An association study of 13 SNPs from seven candidate genes with pediatric asthma and a preliminary study for genetic testing by multiple variants in Taiwanese population.
18927306 2008 Polymorphisms in the interleukin-4 receptor gene are associated with better survival in patients with glioblastoma.
18849614 2009 Analysis of polymorphisms in olive pollen allergy: IL13, IL4RA, IL5 and ADRB2 genes.
18818748 2008 Preterm birth in Caucasians is associated with coagulation and inflammation pathway gene variants.
18813073 2008 Innate immunity of the ocular surface and ocular surface inflammatory disorders.
18809513 2008 Urinary evaluation of the balance between soluble interferon-gamma receptor (IFN-gammaR1) and interleukin-4 receptor (IL-4Ralpha).
18781131 2008 Interleukin and interleukin receptor gene polymorphisms and susceptibility to melanoma.
18774776 2008 Enhanced CCL26 production by IL-4 through IFN-gamma-induced upregulation of type 1 IL-4 receptor in keratinocytes.
18773331 2008 Correlation between genetic polymorphism of cytokine genes, plasma protein levels and bronchial asthma in the Han people in northern China.
18715339 2008 Associations between cytokine/cytokine receptor single nucleotide polymorphisms and humoral immunity to measles, mumps and rubella in a Somali population.
18691306 2008 Study of gene-gene interactions for endophenotypic quantitative traits in Chinese asthmatic children.
18676680 2008 Pathway-based evaluation of 380 candidate genes and lung cancer susceptibility suggests the importance of the cell cycle pathway.
18674658 2008 Genetic regulation of cervical antiinflammatory cytokine concentrations during pregnancy.
18636124 2008 Polymorphisms in the estrogen receptor 1 and vitamin C and matrix metalloproteinase gene families are associated with susceptibility to lymphoma.
18633131 2008 Host immune gene polymorphisms in combination with clinical and demographic factors predict late survival in diffuse large B-cell lymphoma patients in the pre-rituximab era.
18632425 2008 Cytokine single nucleotide polymorphisms in Iranian populations.
18628242 2008 Cytokine gene polymorphisms and the risk of adenocarcinoma of the stomach in the European prospective investigation into cancer and nutrition (EPIC-EURGAST).
18625055 2008 Lack of association or interactions between the IL-4, IL-4Ralpha and IL-13 genes, and rheumatoid arthritis.
18610832 [Association of immune system gene polymorphisms with quantitative features which are pathogenetically important in chronic viral hepatitis].
18610831 [Genetics factors determining predisposition to chronic course of virus hepatitis and fibrosis in liver].
18576348 2008 A variant of the IL4 I50V single-nucleotide polymorphism is associated with erosive joint disease in psoriatic arthritis.
18547691 2008 Gender-specific effects of cytokine gene polymorphisms on childhood vaccine responses.
18538381 2008 Clinical and genetic risk factors of self-reported penicillin allergy.
18448485 2008 Interleukin promoter polymorphisms and prognosis in colorectal cancer.
18433792 2008 Interleukin 4 receptor is associated with an increase in body mass index in Koreans.
18425216 Association of TGF-beta1, CD14, IL-4, IL-4R and ADAM33 gene polymorphisms with asthma severity in children and adolescents.
18389618 [Influence of polymorphism of immune defense modifier genes on celiac disease development and various clinical features of disease in Tomsk population].
18263811 2008 Association of combined IL-13/IL-4R signaling pathway gene polymorphism with Stevens-Johnson syndrome accompanied by ocular surface complications.
18243101 2008 Molecular and structural basis of cytokine receptor pleiotropy in the interleukin-4/13 system.
18179773 2008 IL-4 -588C>T polymorphism and IL-4 receptor alpha [Ex5+14A>G; Ex11+828A>G] haplotype concur in selecting H. pylori cagA subtype infections.
18095154 2008 Use of expression data and the CGEMS genome-wide breast cancer association study to identify genes that may modify risk in BRCA1/2 mutation carriers.
18031948 2007 Allergies, variants in IL-4 and IL-4R alpha genes, and risk of pancreatic cancer.
18006935 2007 An international case-control study of interleukin-4Ralpha, interleukin-13, and cyclooxygenase-2 polymorphisms and glioblastoma risk.
17988330 2007 Correlation between some Th1 and Th2 cytokine receptor gene polymorphisms and systemic lupus erythematosus in Chinese patients.
17901851 2007 Risk of allergy development correlates with IL-4 receptor expression on newborns' monocytes and Th lymphocytes.
17900677 2007 Association of IL4R polymorphisms with Stevens-Johnson syndrome.
17889143 2007 Cytokine polymorphisms and risk of infection after kidney transplantation.
17823973 2007 Association of IL4R gene polymorphisms with asthma in Chinese populations.
17714919 2007 Associations of IL-2 and IL-4 gene polymorphisms with psoriasis in the Korean population.
17703412 2007 Genetic susceptibility to respiratory syncytial virus bronchiolitis is predominantly associated with innate immune genes.
17688234 2007 Variants of chemokine receptor 2 and interleukin 4 receptor, but not interleukin 10 or Fas ligand, increase risk of cervical cancer.
17627763 2007 Single nucleotide polymorphisms of cytokine genes in the healthy Slovak population.
17600229 2007 Confirmation of an association between the TNF(-308) promoter polymorphism and stroke risk in children with sickle cell anemia.
17586032 2007 Association between Q551R IL4R genetic variants and atopic asthma risk demonstrated by meta-analysis.
17548690 2007 Allergy-related polymorphisms influence glioma status and serum IgE levels.
17536219 2007 Polymorphisms in the IL-4, IL-4 receptor alpha chain, TNF-alpha, and lymphotoxin-alpha genes and risk of asthma in Hong Kong Chinese adults.
17523428 [Alleles distribution of polymorphic promoter region C-590T in interleukin-4 genes and Q-576r and Ile-50Val regions in IL-4 receptor gene IL-4RA in patients with HCV-infection].
17444864 2007 Novel interleukin-4 and interleukin-1 receptor antagonist gene variations associated with non-cardia gastric cancer in Japan: comprehensive analysis of 207 polymorphisms of 11 cytokine genes.
17420820 2007 Study of polymorphisms in the interleukin-4 and IL-4 receptor genes in a population of Brazilian patients with multiple sclerosis.
17362266 2007 Polymorphisms of interleukin (IL)-4 receptor alpha and signal transducer and activator of transcription-6 (Stat6) are associated with increased IL-4Ralpha-Stat6 signalling in lymphocytes and elevated serum IgE in patients with Graves' disease.
17315188 2007 Common variants in genes that mediate immunity and risk of multiple myeloma.
17303794 2007 Ethnicity-specific gene-gene interaction between IL-13 and IL-4Ralpha among African Americans with asthma.
17291854 2007 Parental smoking impairs vaccine responses in children with atopic genotypes.
17284225 2007 Genetic diversity of the IL-4, IL-4 receptor and IL-13 loci in mestizos in the general population and in patients with asthma from three subpopulations in Mexico.
17258448 2007 Interleukin-4 and interleukin-4 receptor polymorphisms and colorectal cancer risk.
17257312 2007 Frequency distribution of cytokine gene polymorphisms in the healthy North Indian population.
17209513 2006 No potential role of genetic polymorphisms for IL-4, IL-13 and IL-4 receptor in respiratory allergy: a study in adults working at social welfare facilities in Korea.
17201240 2006 Diisocyanate asthma and gene-environment interactions with IL4RA, CD-14, and IL-13 genes.
17179726 2007 Candidate-gene association study of mothers with pre-eclampsia, and their infants, analyzing 775 SNPs in 190 genes.
17170387 2007 IL4R alpha mutations are associated with asthma exacerbations and mast cell/IgE expression.
17152005 2007 Associations between measles vaccine immunity and single-nucleotide polymorphisms in cytokine and cytokine receptor genes.
17143971 2007 Polymorphisms in the IL4 and IL4RA genes in Colombian patients with rheumatoid arthritis.
17121586 2006 Influence of SNPs in cytokine-related genes on the severity of food allergy and atopic eczema in children.
17115186 2007 TagSNP evaluation for the association of 42 inflammation loci and vascular disease: evidence of IL6, FGB, ALOX5, NFKBIA, and IL4R loci effects.
17091279 2007 Polymorphisms in the IL-13 and IL-4 receptor alpha genes and allergic rhinitis.
17083349 2006 Interaction between variants in the interleukin-4 receptor alpha and interleukin-9 receptor genes in childhood wheezing: evidence from a birth cohort study.
17045041 2006 [A study on the association between polymorphism of the interleukin-4 receptor alpha gene and bronchial asthma in a population of Han nationality].
17006724 2006 Genetic polymorphisms in anti-inflammatory cytokine signaling and the prevalence of gastric precancerous lesions in Venezuela.
17001290 2006 Gene-gene interactions of IL13 and IL4RA variants in immediate allergic reactions to betalactam antibiotics.
16961803 2006 Polymorphisms in cytokine genes and risk of Helicobacter pylori infection among Jamaican children.
16950281 2006 Associations of a novel IL4RA polymorphism, Ala57Thr, in Greenlander Inuit.
16938461 2006 Cytokine gene polymorphisms can alter the effect of Bacillus Calmette-Guérin (BCG) immunotherapy.
16917945 2006 Common variations in the IL4R gene affect splicing and influence natural expression of the soluble isoform.
16914241 2007 Impact of genetic variants in IL-4, IL-4 RA and IL-13 on the anti-pneumococcal antibody response.
16867043 2006 IL-10 promoter and IL4-Ralpha gene SNPs are associated with immediate beta-lactam allergy in atopic women.
16842617 2006 Interleukin gene polymorphisms and breast cancer: a case control study and systematic literature review.
16757160 2007 IL-4 receptor genetic polymorphisms and asthma in Asian populations.
16750991 2006 Association of IL13 with total IgE: evidence against an inverse association of atopy and diabetes.
16699452 2006 Association of TNFd and IL-10 polymorphisms with mortality in unrelated hematopoietic stem cell transplantation.
16681592 2006 No association of cytokine gene polymorphisms in Chinese patients with atopic dermatitis.
16646030 2006 Association of the IL4R single-nucleotide polymorphism I50V with rapidly erosive rheumatoid arthritis.
16640778 2006 A modular interface of IL-4 allows for scalable affinity without affecting specificity for the IL-4 receptor.
16625214 2006 Multifactor dimensionality reduction reveals gene-gene interactions associated with multiple sclerosis susceptibility in African Americans.
16613701 2006 [Association of Q576R polymorphism in the interleukin-4 receptor gene with serum IgE levels in children with asthma].
16600026 2006 Asthma families show transmission disequilibrium of gene variants in the vitamin D metabolism and signalling pathway.
16551465 2006 Polymorphisms in the interleukin-4 and IL-4 receptor genes modify risk for chronic inflammatory arthropathies in women.
16538488 2006 Lack of association of type 1 diabetes with the IL4R gene.
16503977 2006 IL-4 alpha chain receptor (IL-4Ralpha) polymorphisms in allergic bronchopulmonary sspergillosis.
16403098 2006 Cytokine gene polymorphisms in bullous pemphigoid in a Chinese population.
16387595 2006 Gene-gene interactions for asthma and plasma total IgE concentration in Chinese children.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16313681 2005 Interleukin-4 (IL4) and Interleukin-4 receptor (IL4RA) polymorphisms in asthma: a case control study.
16313303 2005 Polymorphisms in the interleukin-4 and IL-4 receptor genes and multiple sclerosis: a study in Spanish-Basque, Northern Irish and Belgian populations.
16280132 2006 IL4 receptor polymorphism is associated with increased risk of sudden deafness in Korean population.
16264039 2005 dsRNA enhances eotaxin-3 production through interleukin-4 receptor upregulation in airway epithelial cells.
16226465 2005 Serum evaluation of the balance between soluble interleukin-2 and interleukin-4 receptors.
16189667 2005 Polymorphisms in the interleukin-4 receptor alpha chain gene influence susceptibility to HIV-1 infection and its progression to AIDS.
16184405 2005 Interaction between inflammation-related gene polymorphisms and cigarette smoking on the risk of myocardial infarction in the Physician's Health Study.
16100774 2005 Cytokine gene polymorphisms in population of ethnic Macedonians.
16046318 2005 Association of non-HLA genes with type 1 diabetes autoimmunity.
16024651 2005 Polymorphisms associated with asthma are inversely related to glioblastoma multiforme.
15981567 [Association study of the Ile50Val polymorphism of interleukin-4 receptor gene (IL4RA) with chronic viral hepatitis].
15969687 2005 Relationships between specific serum IgE, cytokines and polymorphisms in the IL-4, IL-4Ralpha in patients with penicillins allergy.
15842262 2005 Association of the -159 CD14 gene polymorphism and lack of association of the -308 TNFA and Q551R IL-4RA polymorphisms with severe chronic periodontitis in Swedish Caucasians.
15737301 2005 [IL4RA gene polymorphism (Q576R) is associated with higher total IgE levels in Spanish patients with family history of atopy].
15733644 2005 Genetic variations in IL6 associate with intervertebral disc disease characterized by sciatica.
15712015 2005 Effects of common atopy-associated amino acid substitutions in the IL-4 receptor alpha chain on IL-4 induced phenotypes.
15661890 2005 IFN-gamma suppresses STAT6 phosphorylation by inhibiting its recruitment to the IL-4 receptor.
15660293 2005 No evidence of association or interaction between the IL4RA, IL4, and IL13 genes in type 1 diabetes.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15566952 2004 Cytokine gene polymorphisms in endemic pemphigus foliaceus: a possible role for IL6 variants.
15564773 2004 A comprehensive analysis of interleukin-4 receptor polymorphisms and their association with atopy and IgE regulation in childhood.
15526032 2004 Crosstalk between PKCzeta and the IL4/Stat6 pathway during T-cell-mediated hepatitis.
15521376 2004 Regulatory mechanisms of Th2 cytokine-induced eotaxin-3 production in bronchial epithelial cells: possible role of interleukin 4 receptor and nuclear factor-kappaB.
15497451 2004 Polymorphisms of interleukin 4 receptor gene and interleukin 10 gene are not associated with Graves' disease in the UK.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15479272 2004 Haplotypes of the interleukin-4 receptor alpha chain gene associate with susceptibility to and severity of atopic asthma.
15367225 2004 Relevance of IL10, TGFbeta1, TNFalpha, and IL4Ralpha gene polymorphisms in kidney transplantation: a collaborative transplant study report.
15361128 2004 Cytokine gene polymorphisms in Taiwan.
15356556 2004 Functional effect of the R110Q IL13 genetic variant alone and in combination with IL4RA genetic variants.
15298559 2004 Gene-gene interaction between interleukin-4 and interleukin-4 receptor alpha in Korean children with asthma.
15194285 2004 Impact of donor and recipient cytokine genotypes on renal allograft outcome.
15170937 2004 Association of single nucleotide polymorphisms within cytokine genes with juvenile idiopathic arthritis in the Czech population.
15161635 2004 Human pulmonary fibroblasts exhibit altered interleukin-4 and interleukin-13 receptor subunit expression in idiopathic interstitial pneumonia.
15122773 2004 Hepatic adducts, circulating antibodies, and cytokine polymorphisms in patients with diclofenac hepatotoxicity.
15057902 2004 HLA and cytokine gene polymorphisms are independently associated with responses to hepatitis B vaccination.
15021309 2004 Cytokine and chemokine gene polymorphisms among ethnically diverse North Americans with HIV-1 infection.
15007352 2004 Associations between specific serum IgE response and 6 variants within the genes IL4, IL13, and IL4RA in German children: the German Multicenter Atopy Study.
15007345 2004 Epistatic effect of IL1A and IL4RA genes on the risk of atopy.
15005726 2004 Association of polymorphisms in Th1, Th2 cytokine genes with hayfever and atopy in a subsample of EPIC-Heidelberg.
14984008 2003 Polymorphisms in the interleukin-4 receptor alpha chain: association with traits of allergy and asthma in an admixed population in Hawaii.
14745651 2004 Common variants within the interleukin 4 receptor alpha gene (IL4R) are associated with susceptibility to osteoarthritis.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14657871 2003 High contribution contrast between the genes of eosinophil peroxidase and IL-4 receptor alpha-chain in Japanese cedar pollinosis.
14615367 2004 Gene interactions and stroke risk in children with sickle cell anemia.
14523823 2003 Lower prevalence of IL-4 receptor alpha-chain gene G variant in very-low-birth-weight infants with necrotizing enterocolitis.
12973929 2003 Polymorphisms of IL-4, IL-4R alpha, and AICDA genes in adult allergic asthma.
12960323 2003 The WD motif-containing protein RACK-1 functions as a scaffold protein within the type I IFN receptor-signaling complex.
12940513 2003 Polymorphisms in the IL-4 and IL-4R [alpha] genes and allergic asthma.
12900808 2003 Polymorphisms of interleukin-4--related genes in Japanese children with minimal change nephrotic syndrome.
12897746 2003 Associations between total serum IgE levels and the 6 potentially functional variants within the genes IL4, IL13, and IL4RA in German children: the German Multicenter Atopy Study.
12871855 2003 IL-13 and IL-4 promote TARC release in human airway smooth muscle cells: role of IL-4 receptor genotype.
12753568 2003 Polymorphisms of interleukin-4 promoter and receptor gene for schizophrenia in the Korean population.
12748907 2003 Association and interaction of the IL4R, IL4, and IL13 loci with type 1 diabetes among Filipinos.
12743452 2003 Genetic variants of TNF-[FC12]a, IL-1beta, IL-4 receptor [FC12]a-chain, IL-6 and IL-10 genes are not risk factors for sepsis in low-birth-weight infants.
12594065 2003 Polymorphisms in the IL13, IL13RA1, and IL4RA genes and rate of decline in lung function in smokers.
12558814 2003 Genotyping for cytokine polymorphisms: allele frequencies in the Italian population.
12508140 2003 Association of severe respiratory syncytial virus bronchiolitis with interleukin-4 and interleukin-4 receptor alpha polymorphisms.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12459556 2003 Regulation of the dephosphorylation of Stat6. Participation of Tyr-713 in the interleukin-4 receptor alpha, the tyrosine phosphatase SHP-1, and the proteasome.
12454749 2002 Expression profiling of B cell chronic lymphocytic leukemia suggests deficient CD1-mediated immunity, polarized cytokine response, altered adhesion and increased intracellular protein transport and processing of leukemic cells.
12442007 2002 Molecular analysis of adrenergic receptor genes and interleukin-4/interleukin-4 receptor genes in patients with interstitial cystitis.
12422339 2002 Distribution in allele frequencies of predisposition-to-atopy genotypes in Chinese children.
12420205 2002 Polymorphisms of transforming growth factor-beta1 and transforming growth factor-beta1 type II receptor genes are associated with acute graft-versus-host disease in children with HLA-matched sibling bone marrow transplantation.
12401728 2002 Association of IL4R haplotypes with type 1 diabetes.
12242343 2002 Expression of the suppressor of cytokine signaling-5 (SOCS5) negatively regulates IL-4-dependent STAT6 activation and Th2 differentiation.
12207328 2002 Human lung myofibroblasts as effectors of the inflammatory process: the common receptor gamma chain is induced by Th2 cytokines, and CD40 ligand is induced by lipopolysaccharide, thrombin and TNF-alpha.
12171893 2002 Genetic polymorphisms of the interleukin-4 receptor alpha gene are associated with an increasing risk and a poor prognosis of sporadic renal cell carcinoma in a Japanese population.
12133990 2002 V75R576 IL-4 receptor alpha is associated with allergic asthma and enhanced IL-4 receptor function.
12133952 2002 Two distinct domains within the N-terminal region of Janus kinase 1 interact with cytokine receptors.
12115161 2002 Association of interleukin-4 and interleukin-1B gene variants with Larsen score progression in rheumatoid arthritis.
12100043 2002 An interaction between the IL-4Ralpha gene and infection is associated with atopic eczema in young children.
12082592 2002 Multi-locus interactions predict risk for post-PTCA restenosis: an approach to the genetic analysis of common complex disease.
12047365 2002 No linkage of the interleukin-4 receptor locus on chromosome 16p11.2-12.1 with sarcoidosis in German multiplex families.
12047364 2002 Asthma and IL-4 receptor alpha gene variants.
12020266 2002 Contribution of the interleukin 4 gene to susceptibility to subacute sclerosing panencephalitis.
11991671 2002 Endogenous interferon-alpha production by differentiating human monocytes regulates expression and function of the IL-2/IL-4 receptor gamma chain.
11922633 2002 Genetic variants of the receptors for thromboxane A2 and IL-4 in atopic dermatitis.
11811777 2001 Characterization of IL-4 receptor components expressed on monocytes and monocyte-derived macrophages: variation associated with differential signaling by IL-4.
11786020 2002 The high-affinity interaction of human IL-4 and the receptor alpha chain is constituted by two independent binding clusters.
11773030 2002 Characterization of the interleukin-4 receptor complex in human corneal fibroblasts.
11714803 2001 Immunoreceptor tyrosine-based inhibitory motif of the IL-4 receptor associates with SH2-containing phosphatases and regulates IL-4-induced proliferation.
11709756 2002 Gene-gene interaction in asthma: IL4RA and IL13 in a Dutch population with asthma.
11678851 2001 Lack of association between atopic eczema and the genetic variants of interleukin-4 and the interleukin-4 receptor alpha chain gene: heterogeneity of genetic backgrounds on immunoglobulin E production in atopic eczema patients.
11544427 2001 TNF-alpha, IL-6, IFN-gamma, and IL-10 gene expression polymorphisms and the IL-4 receptor alpha-chain variant Q576R: effects on renal allograft outcome.
11528525 2001 Interleukin-4 and interleukin-4 receptor gene polymorphisms in inflammatory bowel diseases.
11513543 2001 Analysis of the Ser786Pro interleukin-4 receptor alpha allelic variant in allergic and nonallergic asthma and its functional consequences.
11491529 A novel polymorphism in the 5' promoter region of the human interleukin-4 receptor alpha-chain gene is associated with decreased soluble interleukin-4 receptor protein levels.
11354638 2001 Cross-sectional study on cytokine polymorphisms, cytokine production after T-cell stimulation and clinical parameters in a random sample of a German population.
11285129 2001 Identification of a novel single-nucleotide polymorphism (Val554Ile) and definition of eight common alleles for human IL4RA exon 11.
11233912 2001 Donor cytokine genotype influences the development of acute rejection after renal transplantation.
11164908 2001 Analysis of interleukin-4 receptor alpha chain variants in multiple sclerosis.
11035134 2000 IL-4 VNTR gene polymorphism in chronic polyarthritis. The rare allele is associated with protection against destruction.
10856136 2000 IL-4/IL-13 signaling beyond JAK/STAT.
10809862 2000 Interleukin 4 receptor alpha chain polymorphism Gln551Arg is associated with adult atopic dermatitis in Japan.
10677312 2000 Variation in the interleukin 4-receptor alpha gene confers susceptibility to asthma and atopy in ethnically diverse populations.
10652211 2000 Possible involvement of Shc in IL-4-induced germline epsilon transcription in a human B cell line.
10590262 1999 Characterization of the membrane-bound and a soluble form of human IL-4 receptor alpha produced by alternative splicing.
10493829 1999 Genome duplications and other features in 12 Mb of DNA sequence from human chromosome 16p and 16q.
10421786 1999 Activation of STAT5 by IL-4 relies on Janus kinase function but not on receptor tyrosine phosphorylation, and can contribute to both cell proliferation and gene regulation.
10390422 1999 No association between atopy/asthma and the ILe50Val polymorphism of IL-4 receptor.
10369419 1999 Association of the interleukin-4 receptor alpha chain with p47phox, an activator of the phagocyte NADPH oxidase in B cells.
10358772 1999 The IL-4 receptor: signaling mechanisms and biologic functions.
10341317 1999 Soluble human interleukin-4 receptor is produced by activated T cells under the control of metalloproteinases.
10233717 1999 The polymorphisms S503P and Q576R in the interleukin-4 receptor alpha gene are associated with atopy and influence the signal transduction.
10219247 1999 Crystal structure of the interleukin-4/receptor alpha chain complex reveals a mosaic binding interface.
10201973 1999 Cutting edge: effects of an allergy-associated mutation in the human IL-4R alpha (Q576R) on human IL-4-induced signal transduction.
9761767 1998 Human eosinophils constitutively express a functional interleukin-4 receptor: interleukin-4 -induced priming of chemotactic responses and induction of PI-3 kinase activity.
9697832 1998 FRIP, a hematopoietic cell-specific rasGAP-interacting protein phosphorylated in response to cytokine stimulation.
9670964 1998 Regulation of apoptosis by tyrosine-containing domains of IL-4R alpha: Y497 and Y713, but not the STAT6-docking tyrosines, signal protection from apoptosis.
9651359 1998 Mutational analysis of the STAT6 SH2 domain.
9620765 1998 Ile50Val variant of IL4R alpha upregulates IgE synthesis and associates with atopic asthma.
9545332 1998 A role for the insulin-interleukin (IL)-4 receptor motif of the IL-4 receptor alpha-chain in regulating activation of the insulin receptor substrate 2 and signal transducer and activator of transcription 6 pathways. Analysis by mutagenesis.
9515586 1998 Linkage and allelic association of atopy and markers flanking the IL4-receptor gene.
9392697 1997 The association of atopy with a gain-of-function mutation in the alpha subunit of the interleukin-4 receptor.
9190938 1997 The IL-4 receptor alpha-chain cytoplasmic domain is sufficient for activation of JAK-1 and STAT6 and the induction of IL-4-specific gene expression.
9070874 1997 Common polymorphisms in the coding part of the IL4-receptor gene.
8954948 1996 Interleukin-4 activates two distinct pathways of phosphatidylinositol-3 kinase in the same cells.
8916957 1996 Interleukin-4 induces association of the c-fes proto-oncogene product with phosphatidylinositol-3 kinase.
8910586 1996 cDNA cloning and characterization of the human interleukin 13 receptor alpha chain.
8891114 1996 Transcriptional up-regulation of interleukin 4 receptors by human immunodeficiency virus type 1 tat gene.
8816495 1996 Requirements for interleukin-4-induced gene expression and functional characterization of Stat6.
8804422 1996 IL4 and IL13 receptors share the gamma c chain and activate STAT6, STAT3 and STAT5 proteins in normal human B cells.
8624803 1996 Growth and gene expression are predominantly controlled by distinct regions of the human IL-4 receptor.
8609418 1996 IL-13 induces phosphorylation and activation of JAK2 Janus kinase in human colon carcinoma cell lines: similarities between IL-4 and IL-13 signaling.
8599766 1996 Structural basis for IL-4 receptor phosphopeptide recognition by the IRS-1 PTB domain.
8266078 1993 Interleukin-2 receptor gamma chain: a functional component of the interleukin-4 receptor.
8266076 1993 Sharing of the interleukin-2 (IL-2) receptor gamma chain between receptors for IL-2 and IL-4.
8222329 1993 Anti-CD28 antibody- and IL-4-induced human T cell proliferation is sensitive to rapamycin.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
8124718 1994 An IL-4 receptor region containing an insulin receptor motif is important for IL-4-mediated IRS-1 phosphorylation and cell growth.
8101483 1993 Receptors for interleukin-13 and interleukin-4 are complex and share a novel component that functions in signal transduction.
7775445 1995 The primary binding subunit of the human interleukin-4 receptor is also a component of the interleukin-13 receptor.
7721895 1995 Activation of JAK3, but not JAK1, is critical to interleukin-4 (IL4) stimulated proliferation and requires a membrane-proximal region of IL4 receptor alpha.
7538655 1995 JAK3 associates with the human interleukin 4 receptor and is tyrosine phosphorylated following receptor triggering.
7518439 1994 Interaction of the c-fes proto-oncogene product with the interleukin-4 receptor.
2307934 1990 Human interleukin 4 receptor confers biological responsiveness and defines a novel receptor superfamily.
2278997 1990 Molecular cloning of a cDNA encoding the human interleukin 4 receptor.
2114443 1990 Differential regulation of IL-1 production in human monocytes by IFN-gamma and IL-4.
1679753 1991 The interleukin-4 receptor gene (IL4R) maps to 16p11.2-16p12.1 in human and to the distal region of mouse chromosome 7.
1617647 1992 Human immunodeficiency virus type 1 tat gene up-regulates interleukin 4 receptors on a human B-lymphoblastoid cell line.