Property Summary

NCBI Gene PubMed Count 992
PubMed Score 8890.74
PubTator Score 6054.65

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count
Ischemic stroke 12

Expression

Protein-protein Interaction (7)

Gene RIF (1084)

PMID Text
27080531 Interleukin-4 used with GM-CSF and TNF-alpha during the maturation of DCs in vitro impaired dendritic cells (DC) functions.
26927386 Data show that during chronic HBV infection, interferon gamma (IFN-gamma) and interleukin 4 (IL-4 )expressed by peripheral blood T cells play dual immunoregulatory roles, which are correlated with the efficacy of entecavir.
26879815 Reported is the distribution of allelic and genotypic frequencies of IL1A, IL4, NFKB1 and PAR1 variants in Native American, African, and European populations of Brazil and their association with predisposition to cancer.
26861613 The IL-4 rs79071878 polymorphism, was associated whereas the IL-1Ra rs2234663 polymorphism was not associated with Familial Mediterranean Fever risk in the Turkish population.
26831416 investigated five SNPs (C-589T and C-33T of IL4, G+2044A of IL13, A+1902G of IL4Ralpha, and A+896G of TLR4) in patients with adult onset asthma to evaluate their role in manifestation and severity of asthma
26829670 interleukin-4 regulates hematopoietic lineage choice by activating the JAK3-STAT6 pathway, which causes dendritic-cell-specific DNA demethylation
26758199 A constitutively activated form of STAT6 is able to bypass IL-4 upstream signalling and instruct dendritic-cell-specific functional DNA methylation changes
26755820 By regulating the polymerase III activity, IL-4 potently decreased the biogenesis of tRNA-Glu and, subsequently, td-piR(Glu).
26751822 IL4 expression in follicular fluid and follicular fluid lymphocytes of PCOS patients is not significantly different from controls.
26732352 Analysis of peripheral leucocytes, eosinophils, immunoglobulin E, and IL-4 and IL-10 concentrations presented significantly higher values in children with radiologically confirmed liver granuloma than in uncomplicated hepatomegaly.
26562652 Studied IL-4 signaling and identified reversible protein tyrosine phosphatase (PTP) oxidation as the primary redox regulatory mechanism in the pathway.
26517657 IL-4 polymorphisms might be associated with the ability of the host to control Paracoccidioides sp.infection.
26515179 Patients with occupational allergic dermatoses showed significantly higher frequency of polymorphic variants of cytokine genes IL4 C589T, IL10 C819T, IL10 G1082A, IL10 C592A, and TNF G308A in comparison with the population control.
26507707 Multicolor flow-cytometric analysis of milk allergen-specific T-helper type 2 cells revealed coexpression of interleukin-4 with Foxp3
26504066 The TT genotype of IL-4 C-589T compared to the CC wild-type genotype may have a protective effect on lung cancer risk.
26440137 Studies indicate that cytokine interleukin-4 has an important role in pemphigus disease.
26436920 IL-4 induces miR-142-5p and downregulates miR-130a-3p in macrophages, regulating macrophage profibrogenic gene expression in chronic inflammation.
26405199 piRNA (piR30840) significantly downregulated interleukin-4 (IL-4) via sequence complementarity binding to pre-mRNA intron, which subsequently inhibited the development of Th2 T-lymphocytes
26383107 The present study revealed an association of IL4 2R allele and 2R carrier genotypes in the etiopathogenesis of gastric cancer in south Indian population.
26334904 The IL-4 -590C > T polymorphism is associated with an increased risk of hepatitis C infection and hepatocellular carcinoma, especially among the Asian population.
26289664 In Chinese Han children, the IL-4 -590C/T and -33 C/T polymorphisms were associated with the susceptibility to Respiratory syncytial virus (RSV) infection and the severity of the infection.
26288354 CD4+ T cells from atopic dermatitis patients directly interacted with TSLP to produce a higher amount of IL-4 than those from normal subjects, and this action was attenuated with anti-TSLPR antibody
26281177 Study results have demonstrated, that of all investigated polymorphic variants of genes IL4 (C-590T), IL4RA (150V), TNF (G-308A) and SLC11A1 (D543N) in patients with chronic liver diseases of various etiology
26276392 limiting ALOX15 expression by AMPK may promote an anti-inflammatory phenotype of IL-4-stimulated human macrophages
26265379 However, no significant association was observed between the DDX39B -22 G/C polymorphism in the cases and controls. Furthermore, it is clarified that the protective effect of IL-4 -590 is independent from APOE protective genotypes
26231284 IL-4-induced apoptosis of endothelial cells, may be deleterious and may eventually lead to the aggravation of inflammatory processes and the prolongation of tissue dysfunction.
26138543 elevation of serum IL-4 in Sudanese children suffering from Plasmodium falciparum malaria correlated with the severity of malaria hyperparasitaemia rather than with the severity of the disease
26111352 Suggest IL-4 as marker of allergic airway inflammation in asthma, and roles for adiponectin and neuropeptide Y in neurohormonal signaling.
26111149 Data suggest that IL4 and IL8RB loci may have a small-effect genetic impact on the risk of developing rheumatoid arthritis.
26093164 IL-4 signaling plays a pivotal role in the regulation of vascular cell phenotypes, and atherogenesis
26088754 review of IL-4 and IL-13 mast cell immunity and detail of the differences that exist between mouse and human mast cell responses to IL-4 and IL-13 [review]
26073683 description of differential expression and non-canonical regulation of IL-4 and IL-13 in various immune cells [review]
26070934 review of the roles IL-4 and IL-13 play in allergic inflammatory states and the utility of their modulation as potential therapeutic strategies for the treatment of allergic disorders [review]
26046681 Results showed the salivary expression level of IL-4, 10, 13 and IL-1RA were raised in oral squamous cell carcinoma patients and IL-1RA were correlated with poorly differentiated tumors.
26044597 analysis of how expression of Th2 cytokines, especially IL-4 and IL-13, are regulated in Th2 cells [review]
25985710 Peripheral blood mononuclear cells from severe asthmatic children release lower amounts of IL-12 and IL-4 after LPS stimulation.
25973044 IL-4/IL-13 signature is an independent predictor of outcomes in patients with localized clear-cell renal cell carcinoma
25952120 Igepsilon gene transcription is regulated by histone modifications in the IL-4/STAT6 pathway.
25935236 Our findings indicate that the genetic interaction between these two IL-4 variants is a key factor of severe malaria susceptibility, probably because of its direct role in IL-4 regulation.
25922277 This study indicated that the polymorphisms identified in the IL-4 gene are not likely to play a role in the regulation of the antibody response against PvAMA-1 and IL-4 production in vivax malaria.
25826984 The study found that the genetic risk factor for the development of CLL is allele -590T IL-4 (OR=-1,45).
25819429 review of spatiotemporal control of IL4 and type 2 cytokine signalling, its implications for bystander cells, and its significance during co-infection [review]
25814340 discussion of the role and history of IL4 [review]
25747600 There was an association of IL4 rs2227284 polymorphism with reduced asthma risk. IL-4 serum expression levels were significantly higher in M. pneumonia positive subjects.
25733581 Follicular lymphoma CD10(pos) follicular helper T cells specifically display an IL-4(hi)IFN-gamma(lo) cytokine profile and encompass the malignant B-cell-supportive follicular helper T cells subset.
25682112 IL-4 stimulates cholinergic differentiation of retinal cells.
25674935 Increased level of IL4 is associated with the development of chronic rhinosinusitis with nasal polyps.
25667413 Data suggest that filarial infection induces Ag-specific interleukin 4 (IL-4) responses in distinct T cell memory compartments to Mycobacterium tuberculosis-specific Ags.
25666199 The IL-4 -589C allele is a susceptibility factor in the development of EV71 disease in Chinese children.
25646481 selective IL-4-mediated IL-23/T(H)17 silencing is promising as treatment against harmful inflammation, while sparing the IL-12-dependent T(H)1 responses
25585038 TRPV1 expression level, IL-4 level, and rs4790522 site mutation are the main risk factors inducing bronchial asthma in children
25537796 The results suggested that IL4 -589C/T polymorphism conferred a risk factor of pediatric asthma.
25530681 IL-4 gene polymorphisms may influence the function of mononuclear cells to produce not only interleukin-4 but also other cytokines, especially in patients with chronic periodontitis
25454624 The study found no possible association of functional IL-4 polymorphisms with Indian Visceral Leishmaniasis.
25450271 IL-4-590 C/T polymorphism (C/C + C/T frequencies) may be a potential susceptibility marker for female SCC patients in China.
25418473 RGC-32 expression on M2-polarized and tumor-associated macrophages is M-CSF-dependent and enhanced by tumor-derived IL-4.
25413124 results suggest that miR-155 might be involved in the pathogenesis of ITP by regulating cytokine profiles, which may be mediated by miR-155 targeting SOCS1.
25343318 The C allele of the +33 (C/T) polymorphism in the IL4 gene was associated with susceptibility to dental implant loss in Brazilians in the studied population.
25330798 Study demonstrated for the first time the association between certain allele, genotype, and haplotype frequencies in IL-4 gene with febrile seizure in the Iranian population
25320043 Particular IL-4 gene variants are associated with juvenile systemic lupus erythematosus and might have a role in the pathophysiology of disease.
25310970 uPAR has a role in inducing expression of TGFbeta and interleukin-4 in cancer cells to promote tumor-permissive conditioning of macrophages
25308608 study provides preliminary evidence that there is no statistically significant association between IL-4 and IL-10 genotypes/haplotypes and the risk of antituberculosis drug-induced hepatotoxicity in Chinese population
25303100 Tropical endomyocardial fibrosis patients have elevated plasma levels of pro- and anti-inflammatory cytokines, especially TNFA, IL-4, and IL-10, which were significantly higher than those in healthy subjects.
25295591 genetic variants in IL-4 -590C/T and -33C/T polymorphisms may be a risk factor for CHB in Chinese males but not for HBV-related LC or HCC
25286078 These findings demonstrate that the IL-4 rs2243250 genetic variant might play a key role in the development of autoimmune thyroid diseases. (Meta-analysis)
25239315 The interleukin-4 gene-associated single- nucleotide polymorphism rs2243250 was strongly associated with Clostridium difficile infection in an inflammatory bowel disease population.
25189918 Although, there is no correlation between IL4 VNTR polymorphism and ACE gene polymorphism and CAD, there is a strong association between CAD and co-existence of IL-4 VNTR and ACE gene polymorphisms in the Turkish population.
25170298 The findings suggest that the T allele of the SNP C-33T in the IL-4 gene and the C allele of the SNP S503P in IL-4R may have a protective role against glioma development.
25060515 Our findings suggest that there is an association of the MTHFR gene C677T polymorphism with the susceptibility of a person for development of AS.
25051072 Combined polymorphisms of IL4 and IL10 genes were associated with greater risk of ITP
25029213 Based on current evidence, IL-4 -33 C/T and 70-bp polymorphisms were not associated with increased risk of periodontitis. IL-4 -590 T allele and TT genotype were associated with increased risk of periodontitis in whites.
25017270 our data do not support a role of the IL-4 gene in the pathogenesis of preeclampsia in Taiwanese women.
24991184 IL-4 and melatonin inhibited inflammation and angiogenesis triggered by high glucose and IL-1beta.
24960198 These results suggest that IL-4Ralpha locating in non-lipid raft region is a target molecule for strictinin in inhibiting STAT6 activation.
24949794 genetic associations between common single nucleotide polymorphisms in RIG-I-like receptor and IL-4 signaling genes and severe respiratory syncytial virus infection in children
24943510 we delineate the detailed molecular pathway for IL-4 up-regulation of IL-19 in keratinocytes, which may play an important role in AD pathogenesis.
24939291 Studies indicate that interleukin-4 (IL-4) gene -590 TT genotype may increase the risk of allergic rhinitis and the T allele mutation of -33 might be correlated with allergic rhinitis.
24933945 The character of the morphological changes of the mucous membrane of the large intestine and the genetic polymorphism of IL-1RA, IL-1B, IL-4 TNFA in patient with irritable bowel syndrome
24920818 HIV-1 gp120 induces release of IL-4 in CD4+ T cells
24877103 The results showed that carriage of IL-4 VNTR RP2 allele has positive association with preeclampsia susceptibility.
24872120 These findings suggest that inflammatory mediators are associated with the development of morning and evening fatigue
24850227 IL-1RN and IL-4 gene polymorphisms are potential genetic markers of susceptibility to bladder cancer.
24834774 The results of this meta-analysis suggest that the IL-4 -33C/T polymorphism is a risk factor for asthma
24828787 The anti-apoptotic phenotype of chronic lymphocytic leukemia involves a sensitized response for IL4 dependent STAT6 phosphorylation, and an activation of NF-kB signaling due to an increased affinity of sCD40L to its receptor.
24819208 Polymorphisms for the genes ACE(I/D), CCR-5, IL-1RA, MBL-2, TLR-4, and IL-4 were typed by polymerase chain reaction (PCR) and/or PCR-restriction fragment length polymerase
24815430 The data indicate no association between the two single nucleotide polymorphisms of IL-4-590 and IL-8-251 with overall gastric cancer risk.
24808368 Intravenous immunoglobulin treatment in humans suppresses dendritic cell function via stimulation of IL-4 and IL-13 production.
24778440 The determination of the IL-4 isoform-expressing cells in humans might allow the identification of Th2 precursor cells, which could provide novel intervention strategies directed against Th2-driven immunopathologies such as allergies.
24742632 the IL-4Ralpha and the STAT6 polymorphism may play a role in susceptibility to AD. In addition, gene-gene interaction between the IL-4, the IL-4Ralpha and the STAT6 significantly increases an individual's susceptibility to AD.
24738292 cagocel lead to an increase of IL-4 (p > 0.05), IL-2, IFN-gamma (p < 0.05) and decrease of TGF-beta and IL-12 (p < 0.05). At the same time basic therapy facilitated a significant increase of IL-5 and decrease of IL-6, IL-12, IFN-gamma.
24732061 this study examined the expression of IL-4 mRNA, IFN-c mRNA and FcaRI mRNA in tonsillar mononuclear cells of IgA nephropathy9(IgAN) patients and non-IgAN patients.
24707478 The frequencies of both the T allele on the IL-4-590 and the C on the IL-6-174 were significantly increased in RA patients.
24680475 IL-4 gene P1P1 genotype was associated with Familial Mediterranean fever
24679691 Plasma lipids, atherogenic risk factors and leukocyte functionality are important for the atherogenic process.
24668571 No statistically significant differences were found between the nasal polyps patients and the control group with regard to genotype distribution and allele frequencies of C/T polymorphism of IL4 gene.
24666229 Data suggest that IL-4, IL-15, and VEGF, may play roles in the pathogenesis of myasthenia gravis (MG).
24634237 This meta-analysis showed that IL-4 C-589T and C-33T were associated with asthma in Europeans.
24628947 The present study suggests that the IL-4 rs2243250 polymorphism might be associated with genetic susceptibility to autoimmune diseases, including rheumatoid arthritis and multiple sclerosis.
24521636 The present results indicate that IL-4 seems to play an important role in the development of ILD in patients with RA.
24518693 Rs2243268-A and rs2243274-G of the IL-4 gene were found to confer resistance to extrapulmonary and severe TB in Chinese Han children.
24510574 Polymorphisms of IL-4 gene are not associated with susceptibility to asthma.
24510479 modulates epithelial junction proteins, thereby contributing to the leaky epithelial barrier
24491812 IL-4 variable number of tandem repeats polymorphism is a high risk factor for asthma in the studied North Indian population.
24464250 meta-analysis suggests that IL-4 -588C>T polymorphism might not be a risk factor for non-Hodgkin's lymphoma risk
24463336 the -590C and -1098G alleles located in the promoter of IL-4 may increase the susceptibility to AD among the Han Chinese and might be used as molecular markers for AD risk evaluation.
24463275 The comparison between the cytokine profiles of ET and PV patients showed a statistically significant increase of IL-4, IL-8, GM-CSF, interferon -gamma, MCP-1, PDGF-BB, and VEGF in the ET group
24460857 Data indicate that all evaluated cytokines IFN-gamma, TNF-alpha, IL-4, IL-6 and IL-10 were elevated significantly in immune thrombocytopenic purpura (ITP) patients compared to controls.
24447084 Allergen-specific IL-4- and IL-13-producing T cells were only detected in HDM-allergic asthmatic children (not in patients with non-allergic asthma). Their numbers correlated with clinical severity of allergic rhinitis.
24447082 11beta-HSD2 expression was decreased in allergic nasal mucosa. In cultured epithelial cells treated with IL-4, IL-5, IL-13, and IL-17A, 11beta-HSD1 expression and activity increased in parallel with the expression levels of CYP11B1 and cortisol
24406619 Significant association of interleukin-4 gene intron 3 VNTR polymorphism with susceptibility to knee osteoarthritis in a Turkish population.
24318972 study suggests that IL-4 -524C > T polymorphism may be not associated with an increased colorectal cancer susceptibility
24313289 Our results suggest that IL-2 (-330T/G), IL-4 (-589 C/T) and TGF-beta1 (+869T/C) gene polymorphisms may be associated with TB susceptibility.
24280725 Our results showed that IL-4 or IL-13 acted on differentiating keratinocytes in vitro at early stages to attenuate the gene expression.
24272083 meta-analysis indicated that elected -590C > T polymorphism of IL-4 may not be a risk factor for non-Hodgkin's lymphoma development
24218339 we conclude that IL-4 -589C>T may be not a risk factor for colorectal cancer
24169152 The T, RP1/T, RP1 diplotype of IL-4 was associated with an increased risk but favourable prognosis of OPSCC (oral/pharyngeal carcinomas).
24167373 Heterozygous genotypes (IL-4-590 CT and IL-13-1112 CT) could be considered as risk factors, while the homozygous wild types (-590 CC and -1112 CC) might be considered protective to T2DM.
24164868 There is an increasing anti-cancer protection with increased numbers of alleles associated with higher levels of TGF-beta1 and IL-4.
24161121 genetic polymorphism is associated with progression of the hepatitis B to cirrhosis
24119107 TNF a and EGF were significantly altered in VCP disease as compared to control. No significant differences were observed in IL-4 and IL-6.
24107646 activation of the IL-4/STAT6 signaling pathway has a crucial role in aberrant glycosylation of IgA1 secretion, which is mediated by HIPK2
24089996 Data indicate that the 30-kDa and 38-kDa Mycobacterium tuberculosis antigens showed a bias towards IL-4 secretion of CD4+ T cells.
24078930 in the type 2 diabetes mellitus group, significantly higher IL-4 level on the first and the third post dengue virus infection days, while higher IL-10 and granulocyte-macrophage colony-stimulating factor were detected on the third postinfection day.
24075353 Homozygosity for the C allele of rs2243250 in IL-4 was significantly overrepresented in the patient group. CC genotype in rs2070874 significantly was correlated with allergic rhinitis.
24072495 Based on our meta-analysis, IL-4 (-590C>T) polymorphism was associated with a lower gastric cancer risk under dominant model and allelic model in Caucasians
24049167 HIV-1 gp120 induces release of IL-4 in CD4+ T cells
24007654 haplotype of the IL4 gene which was previously associated with susceptibility to CP, was related to differences in the IL-4 protein levels in the GCF.
23984295 SNP T-590 allele causes hyperproduction of IL-4 and is associated with an uncontrolled course of atopic bronchial asthma
23983153 genetic variation in IL4 was not associated with progression of joint damage in rheumatoid arthritis
23964553 IL4 SNP rs2243290 was significantly associated with the risk of asthma in Japanese women.
23958647 IL-4 confers resistance to IL-27-mediated suppression on CD4+ T cells by imparing STAT1 signaling in asthmatic patients.
23936398 co-occurrence of high TNF-alpha and IL-4 levels along with a high ratio of IFN-gamma/IL-10 may increase the susceptibility of HIV-TB co-infected patients to hyper-inflammation and TB relapse
23935100 IL-4 induces cellular senescence through independent signaling pathways involving STAT6 and p38 MAPK in some human renal cell carcinoma cell lines.
23924473 Polymorphisms rs2243250 and rs2070874 of IL-4 and rs1801275 and rs1805011 of IL4R were associated with asthma.
23923066 A synergic action was noted between TGF-beta1, IL-4 and IL-17A in terms of induction of bronchial epithelial-mesenchymal transition
23913957 These results identify mTOR activation to be a trigger of IL-4 production and necrotic death of double-negative T cells in patients with systemic lupus erythematosus.
23883285 The IL-4 -590 T/C polymorphism is associated with susceptibility to rheumatoid arthritis (RA) in Europeans, but the IL-4R 1902 G/A polymorphism is not associated with RA in Europeans.
23844087 TLR3-induced placental miR-210 down-regulates the STAT6/interleukin-4 pathway, and this may contribute to the development of preeclampsia.
23831512 results suggest that IL-4 VNTR polymorphism in the intron 3 region may be a risk factor for the development of AA among Turkish population
23797532 Persistence of low vitamin D status at birth and in early childhood increased the risk of food sensitization, particularly among children carrying the Il4 C allele of rs2243250.
23774696 In this study, we assessed the association of IL-4 (-590 C>T) and IL-4R (Q551R A>G) gene polymorphisms with the susceptibility and clinical pattern of vitiligo in Saudi patients
23771787 The distribution of genotype frequencies of IL-4 gene intron 3 VNTR polymorphism was statistically different between diabetic neuropathy patients and control group.
23768103 The current meta-analysis indicates that the IL-4 -590T polymorphism may play an important role in increasing HBV and HCV infection risks, especially among Caucasian populations.[meta-analysis]
23766027 The IL-4 variable number of tandem repeats polymorphism was significantly associated with ischemic stroke.
23756192 Intron 3 VNTR polymorphism in the IL4 gene is associated with recurrent aphthous stomatitis susceptibility in Turkish population.
23756167 The results of this study suggest that intron 3 VNTR polymorphism of the IL-4 gene was positively associated with predisposition to develop multiple sclerosis in Turkish population.
23748736 Evaluated whether subjects with different IL4 haplotypes (TCI/CCI and TTD/CTI) would be differentially colonized by periodontopathogens and whether they would respond differently to non-surgical periodontal therapy.
23742784 these data demonstrates that Th-2 immune response, exhibited through increased IL-4 and low IL-2, constitutes a fundamental feature of coronary artery ectasia.
23694808 Il-31 is not a TH2 cytokine in the classical sense but is likely to be expressed by a number of cells in an allergic situation in which IL-4 is present and possibly contribute to the allergic reaction.
23685257 these findings suggest that there is an association of IL-4 gene 70bp VNTR polymorphism and MTHFR C677T polymorphism with susceptibility of a person for development of Rheumatoid arthritis.
23677722 Certain alleles, genotypes, and haplotypes in IL-4 gene were over represented inpatients with IHF, which may, in turn, predispose individuals to this disease.
23668806 The consequences of IL-4 and IL-10 gene polymorphisms on biological parameters and antibody levels were investigated among 576 mothers at delivery and their newborns in the context of P. falciparum placental malaria infection.
23654077 IL-4 gene polymorphisms at rs2243250 and rs2227284 are significantly associated with asthma and allergic rhinitis in Pakistani patients.
23651591 Rs2243250, rs2070874 and rs2227284 polymorphisms in IL4 gene may play an important role in determining the response to hepatitis B vaccine.
23644020 An association between IL-4 gene 70 bp VNTR polymorphism and susceptibility of a person for development of fibromyalgia.
23591975 Anti-inflammatory/regulatory cytokine microenvironment mediated by IL-4 and IL-10 coordinates the immune response in hemophilia A patients infected chronically with hepatitis C virus.
23576103 The current meta-analysis suggested that the -590C/T polymorphism in the IL-4 gene might not be associated with increased/decreased risk of cancer.
23572437 IL-4 rs2243250 polymorphism was associated with decreased oral cancer risk in both the homozygote contrasts and the dominant genetic model, as well as increased renal cell cancer risk in both the homozygote contrasts and the recessive genetic model [meta-analysis]
23559861 The IL-4 gene 70 bp variable number of tandem repeats polymorphism is associated with susceptibility to development of Behcet's disease.
23527710 TNF-alpha-308A and -238A, IL-4-590T, IL-4Ralpha+1902, and IL-1alpha-889C polymorphisms are positively associated with clinically relevant asthma in Italian caucasians.
23527200 Increasing IL-4 and IL-12p40 production by bronchoalveolar lavage cells are biomarkers for Acid-fast bacillus in sputum of patients who present with radiographically advanced tuberculosis.
23511027 IL4-590*T associates with an increased prevalence of HIV-associated sensory neuropathy including following correction for age, height and CD4 T-cell count.
23454622 The meta-analysis suggests that IL-4 -589C/T polymorphism is a risk factor of asthma.
23398789 IL-4 C-589T and C+33T polymorphisms may be risk factors for asthma (Meta-Analysis)
23394902 IL-4 variable number of tandem repeats and IL-4-590 promoter polymorphisms may be helpful for assessing rheumatoid arthritis severity in Egyptian population.
23376457 Data suggest that genetic variability of the IL4/IL4R could have an effect in the clinical course of the disease instead of increasing or decreasing the susceptibility to endemic pemphigus foliaceus.
23351078 These data show that IL-4 and IL-13 decrease kinin receptors in a STAT6-dependent mechanism, which can be one important mechanism by which these cytokines exert their anti-inflammatory effects and impair bone resorption
23334651 High serum IL-4 is associated with disease severity of generalized pustular psoriasis.
23333893 The highest mean serum IL-4 and TNF-alpha concentrations were observed in children with gastroesophageal reflux secondary to cow's milk allergy and in children in the control group (with cow's milk allergy and/or other food allergy diagnosed before treatment.
23333304 HIV-1 gp120 induces release of IL-4 in CD4+ T cells
23306429 The IL-4 and IL-5 correlation to central obesity in adolescent Egyptian girls among proinflammatory and anti-inflammatory cytokines.
23276701 IL-4 +33C investigated. A higher number of pro-inflammatory cytokine risk alleles, and IL-1beta-511T/T genotype individually, were independently associated with both prevalent depression at baseline and persistent depression at one year follow-up.
23259293 There is no difference in IL-4 or IFN-gamma gene methylation between the Han and Uygur allergic rhinitis patients.
23245479 Genetic polymorphism in the IL-4 promoter, ADRbeta2, and ADAM33 is associated with asthma.
23234779 Eosinophils infiltration and increased expression of NGF and IL-4 play key roles in the development of childhood cough variant asthma.
23222300 Changes in tumor proliferation, survival, and metastatic capability have all been ascribed to IL-4 and/or IL-13 action.
23185315 In contrast to colonization with S. aureus alone, co-colonization with lactobacilli associated with suppression of IL-4- (p = 0.004), IL-10- (p = 0.004) and IFN-gamma (p = 0.034) secreting cells.
23124025 these results have major implications for understanding the mechanism and function of alternatively activated monocytes/macrophages by IL-4 and IL-13 and add novel insights into the pathogenesis and potential treatment of various inflammatory diseases.
23110190 Study suggests that the IL-4 polymorphisms regulate host susceptibility to malaria and disease progression.
23107766 this meta-analysis suggested that recipient IL-4 -590C/T polymorphism was associated with acute rejection of liver transplantation, but nor renal or heart transplantation.
23087426 [review] A crucial role is illustrated for IL-4 in the regulation of brain immunity, with measureable downstream effects on spatial learning/memory and neurogenesis, and with implications for neurological disorders.
23070918 A meta-analysis indicates that IL-4 C-33T and C-589T polymorphisms could be proposed as asthma susceptible SNPs.
22997428 patients' sera inhibited STAT6 phosphorylation induced by IL4 binding to CD124, demonstrating that these autoantibodies are functional and suggesting that IL4 neutralization has a pathogenetic role in Autoimmune hepatitis.
22992805 The involvement of the IL-4-induced JAK2-STAT6 signaling and the IFNgamma- or IL-17A-dependent antimelanogenic IL-6 production should be considered as one of the mechanisms explaining the association with hypopigmention in skin diseases.
22986179 The G allele for IL-10 (-1082 A/G), the C allele for IL-4 (+3 C/T) and the C and T alleles for IL-28B (rs12979860 and rs8099917, respectively) are associated with spontaneous viral clearance in hepatitis C infection
22942430 IL-4 downregulates in vitro and in vivo in a STAT6-dependent manner the memory-specific expression of NKG2D transgene, thereby increasing the activation threshold of memory CD8 T cells.
22921153 The associations between physical disorders and incident depression were significant in the presence allele related to lower anti-inflammatory cytokine production (IL-4 +33C).
22892939 IL-9-producing invariant NKT cells protect against DSS-induced colitis in an IL-4-dependent manner.
22884982 This is the first study to demonstrate a significant relationship between IL4 SNP rs2227284 and rhinoconjunctivitis in Japanese women.
22875803 c-Maf increases human immunodeficiency virus (HIV)-1 expression in IL-4-producing CD4 T cells by binding the proximal HIV-1 long terminal repeat (LTR) region and augmenting HIV-1 transcription.
22824342 The C allele in IL-4 is associated with good immune response, but the T allele and TT genotype in IL-4 are associated with poor immune response to hepatitis B vaccines.
22805115 Data indicate that children exposed to secondhand smoke had lower concentrations of IL-1beta, IL-4, IL-5, and IFN-gamma than those with no exposure.
22805022 The IL-4 promoter polymorphisms -33T>C and -590C>T were associated with chronic rhinosinusitis susceptibility, and the -33T/-590T haplotype was a risk factor.
22705603 Acne patients compared to controls showed no significant difference in the frequencies of IL-4 polymorphic genotypes, yet had a highly significant difference in IL-4R genotypes
22675249 We found that a high expression of DC-SIGN could be induced by IL-4 at the levels of mRNA and cell surface protein. Results demonstrated that multiple signaling pathways are involved in IL-4 induced high expression of DC-SIGN on THP-1 cells.
22652416 This meta-analysis suggests that T allele at position -589 of the IL-4 gene promoter region is a low-penetrant risk factor for asthma development especially for Caucasians and atopic type.
22615205 IL-4 is the dominant factor that induces dendritic cell (DC)-SCRIPT mRNA expression in monocyte-derived DCs.
22594992 IL4-590 T/T and -33 T/T genotypes were associated with resistance to the therapy (p<0.001, p=0.001 respectively)
22583827 IL-4 promoter polymorphism is associated with non-small cell lung cancer.
22574929 The extent of both lymphatic proliferation and drainage parallels the progression of lesion severity, as does the up-regulation of pro-lymphangiogenic factors VEGF-C, VEGFR-3, ANG-1, and ANG-2. IL-4-stimulated cells
22538865 address the role of IL-4 in asthma, describe IL-4 signaling, and give an overview of preclinical and clinical studies targeting the IL-4 Receptor pathway
22528336 Our results suggest that the polymorphisms -590C/T in IL4 gene promoter region and -33C/T in the 5'-UTR are not involved in the pathophysiology of paranoid schizophrenia in Polish residents.
22521249 The enhancement of protease activity through increased KLK7 expression by the TH2 cytokines IL-4 and IL-13 might be an important factor for mechanical and chemical epidermal barrier dysfunction in patients with atopic dermatitis.
22512783 polymorphisms of the IL4 gene may be genetic risk for susceptibility for vitiligo and the upregulation of the IL4 transcript, protein and IgE levels in individuals with susceptible haplotypes reveal the crucial role of IL-4 in the pathogenesis of vitiligo
22484276 Genetic determinants IL-4 and IL-4R, may contribute to high anti-hepatitis B titers in immune responses to hepatitis B vaccinations.
22484241 IL-4 failed to up-regulate expression of RP105 at the cell surface. In conclusion, the anti-inflammatory actions of IL-4 occur independently of IL-10, RP105, and the kinase activity of RIPK2
22441356 Expression of IL-4, IL-4R, and IL-13R are involved in the process of local metastases in colorectal cancer, while IL-13 expression has an impact on survival.
22406175 JAK1 and STAT6 may be universal mediators of IL-4 in the suppression of prostaglandin production in human follicular denritic cells.
22387551 Recombinant human IL-4 can integrate with IL-4R on epithelial cells and activate multiple transcription factors, which may bind with the promoter region of PRMT1 to upregulate PRMT1 expression.
22366824 Authors observed a significant difference in the C/C, T/C, and T/T genotypes of the -590 region of IL-4 between patients with multiple sclerosis and healthy controls (P<.001).
22365405 The relationship between genetic polymorphism of IL-4-33 site and silicosis has been found and -33TT is a protective genotype for silicosis.
22358381 IL-4 levels were higher in patients with nasal polyposis and allergic rhinitis.
22249152 IL-4delta2 is natively produced not only as mRNA but also as a protein by cells other than Th1 or Th2; It is regulated post-transcriptionally, is associated with allergic asthma, and regulates production of other cytokines by primary T lymphocytes
22227092 These results suggest that the tested polymorphisms of IL4 gene are unlikely to contribute significantly to biliary atresia susceptibility in Taiwanese children.
22226971 Chromatin Conformation Capture (3C) demonstrated the formation of specific ligation products containing spliced IL-4 and IL-13 DNA sequences in human T(H)2 polarised HuT-78 cells.
22214155 There was no relationship between IL-4 (+45, VNTR) genotypes and prevalence of silicosis. However, workers with IL-4 (-33) allele C are susceptible to silicosis.
22174091 IL-4 triggers a simultaneous activation of the JNK-pathway and the up-regulation of survivin turning on a cancer proliferation mechanism
22170601 Polymorphisms of IL-4, IL-4R and IL-13 genes predicted Chinese bladder cancer risk in 817 bladder cancer and 1,141 controls, were examined.
22157213 This study provides evidence that anti-inflammatory cytokine (IL-4 and IL-10) genes in variant genotypes increase the risk for cervical cancer among passive smokers.
22156341 Th1 and Th17 cells can be repolarized to acquire expression of IL-4 and lose the expression of their characteristic cytokines IFN-gamma and IL-17A, respectively; however, regulatory T cells are largely resistant to repolarization.
22143036 The TT genotypes of the IL-4 gene at the -33 and -589 loci are associated with asthma susceptibility in children, and polymorphism at the -33 locus may be associated with IL-4 level.
22142023 Interleukin-4 -590T/C polymorphism influences the susceptibility to nonsmall cell lung cancer.
22104567 Suggest that multiple tumors and/or carcinoma in situ development are associated with the IL4-590C/T and TNF-308G/A polymorphisms, and emphasize the effectiveness of the BCG schedule.
22092872 IL-4 and IL-13 prime the migrational response of HPC to SDF-1alpha by enhancing the incorporation of CXCR4 into lipid rafts.
22087298 the C-590T polymorphism in IL4 may contribute to the susceptibility to mite-sensitized persistent allergic rhinitis in a Chinese population.
22053598 Five SNPs (rs1800469, rs2241712, rs2070874, rs20541 and rs1800925) in TGF-beta1, IL-4 and IL-13 were genotyped using the MassArray SNP genotyping system.
22045834 Data showed that polymorphisms in IL4, IL13, and their receptors do not play a role in SSc and do not influence the expression of their corresponding transcript in peripheral blood cells.
21989417 Data indicate that both ERK-1 and ERK-2 are involved in the regulation of IL4 gene expression and binding to its promoter.
21966389 IL-4 amplifies the pro-inflammatory effect of adenosine in human mast cells by increasing expression levels of adenosine receptors A2B and decreasing A2A
21913997 did not identify any SNPs in the IL-4, IL-4R and IL-13Ralpha2 genes that were associated with atopic dermatitis
21900165 HIV-1 gp120 induces release of IL-4 in CD4+ T cells
21890374 IRF-4 was shown to enhance the c-Rel-dependent binding and activation of the interleukin-4 (IL-4) promoter region. IL-2 production was also enhanced by exogenously-expressed IRF-4 and c-Rel.
21857939 Results suggest that the IL-4 C-590T polymorphism is involved in the etiology of CWP and susceptibility to this disease.
21846818 Five SNPs were validated as being significantly associated with prostate cancer mortality, one each in the LEPR, CRY1, RNASEL, IL4, and ARVCF genes.
21819409 When examined jointly with SNPs, a significant interaction between IL4 gene polymorphism (rs2243250) and Vitamin D deficiency(VDD)was found: VDD increased the risk of Food Sensitization among children carrying CC/CT genotypes.
21799768 the prolonged IL-4 expression in NFAT1 deficient Th2 cells is mediated by preferential binding of JUNB/SATB1 to the IL-4 promoter with permissive chromatin architecture
21788379 Our data suggest that short exposure of human monocytes to IL-4 induces a phenotypic characteristic of alternative activation and that secreted filarial products skew monocytes similarly.
21771210 IL4-589 CC, -33 CC genotype, and *C allele at both sites appeared to be susceptible in patients with OSCC; these SNPs may be potential prognostic markers for tobacco-related OSCC in Asian Indians.
21755390 elevated IL-4 at 6 months following vaccination is associated with disease progression in tuberculosis-susceptible families
21749213 Our data suggest that the -590T/C polymorphism of the IL-4 gene is associated with decreased susceptibility of leprosy.
21729106 There were no significant differences in the genotype and allele frequency of IL4 and IL10 gene polymorphisms between symptomatic and asymptomatic chagasic heart disease patients.
21713407 The Rp2/Rp2 genotype of IL-4 might have a role to play in reducing risk of HIV-1 susceptibility among a north Indian population.
21690322 Unexpectedly, IL-4 augments TSLP mRNA and protein production in transgenic mice bone marrow-derived dendritic cells.
21658970 The results of our study suggest that serum level of IL-4 may be elevated in concert with decreased level of IFN-gamma in asthma.
21646796 ZFPM1 that facilitates human Th1 differentiation via the downregulation of IL-4 is a potential target for the treatment of allergic diseases.
21645924 IL-4 increased the expression of CXCL-8 in human pulmonary artery endothelial cells but not in pulmonary microvascular endothelial cells or cultured umbilical veins endothelial cells
21644211 study concludes that VNTR polymorphism of the IL-4 gene is a risk factor for the development of end-stage renal disease among Malaysians
21640045 The results of this study could suggest a tendency towards higher production of IL-2 and lower production of IL-4 in the patients with Behcet's disease.
21636115 evidence for a new means of downregulating IL-4 production by basophils, both in vitro and in vivo, through OCT3 targeted by 5-HT and pharmacologic ligands.
21611195 The prototypic Th2 cytokine IL-4 was the only cytokine capable of inducing GATA3 in skin explants from healthy donors.
21501388 Both single nucleotide polymorphisms and their haplotypes were associated with intracerebral haemorrhage, but not ischaemic stroke
21478113 IL-4 was detectable in 25% subjects with Down syndrome and in 28.6% healthy subjects.
21471214 Differential use of chondroitin sulfate to regulate hyaluronan binding by receptor CD44 in Inflammatory and Interleukin 4-activated Macrophages.
21460743 results suggest that the IL-4 -589T/C polymorphism might affect T(H)1/T(H)2 balance and predispose trauma patients to susceptibility sepsis.
21354455 genetic polymorphism is associated with susceptibility to chronic periodontitis in Macedonians
21323696 data suggest that IL-4 gene promoter polymorphisms may affect susceptibility to Behcet's disease in Turkish population and increase risk of developing the disease
21276216 Both IL-1 and IL-4 are involved in the response of annulus fibrosus cells derived from nondegenerative tissue to 1.0-Hz cyclic tensile strain.
21270410 Transgenic green fluorescent protein (GFP)-expressing basophils constitute the major cellular source of IL-4 during the primary response to Nippostrongylus brasiliensis, whereas GFP+ CD4+ T cells are the IL-4 major source during secondary lung infection.
21268015 Signals ensued by IFN-alpha and IL-4 induce cytoplasmic sequestration of IL-4-activated STAT6 and IFN-alpha-activated STAT2:p48 in B cells through the formation of pY-STAT6:pY-STAT2:p48 complex.
21211660 Our study is the first to examine genetic associations between IL4 and Trypanosoma cruzi infection
21198753 There is an increased production of IL-13 by the T cells of aggressive periodontitis patients with the IL-4 genotype
21195738 study showed an association between the IL-4 gene and Graves disease in children
21191414 T(h)2 cytokines, IL-4 and IL-13, modulate Toll-like receptor 9 (TLR-9)- and herpes simplex virus-induced plasmacytoid dendritic cell phenotype and enhance the ability of these cells to induce allogeneic T-cell responses
21133811 Cytokine and chemokine responses to selected early secreted antigenic target-6 and culture filtrate protein-10 peptides in tuberculosis.
21127885 Pattern of IL-4 and IFN-gamma release may identify a subset of patients at risk for rapid progression to severe left ventricular dysfunction despite successful percutaneous coronary intervention.
21111725 The interaction of IL-4 and IL-1RN (receptor antagonist) genetic polymorphisms played an important role in Ischemic stroke in Chinese.
21106524 these results identify PSF as a repressor of STAT6-mediated transcription that functions through recruitment of HDAC to the STAT6 transcription complex, and delineates a novel regulatory mechanism of IL-4 signaling
21106245 Akt play an important role in cross-linking IL-4 priming, SCF signaling, and IgE-dependent activation of mature human mast cells.
21086908 Observational study of gene-disease association. (HuGE Navigator)
21085635 HIV-1 gp120 induces release of IL-4 in CD4+ T cells
21071541 Observational study of gene-disease association. (HuGE Navigator)
21067483 This is the first study to show that polymorphisms in anti-inflammatory cytokine genes are associated with susceptibility to Graves' ophthalmopathy (GO).
21067483 Observational study of gene-disease association. (HuGE Navigator)
21061265 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
21054877 Observational study of gene-disease association. (HuGE Navigator)
21048327 Observational study of gene-disease association. (HuGE Navigator)
20980261 this study provides a model for an IL-4/STAT6-dependent fine tuning mechanism of TCF-1-driven T helper cell polarization
20970781 The culture supernatant of mesenchymal stem cells isolated from stage III breast cancer patients induced upregulation of the mRNA expression levels of IL-4, TGF-beta1, IL-10, CCR4 and CD25 in peripheral blood T lymphocytes.
20942272 Observational study of gene-disease association. (HuGE Navigator)
20921925 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20880001 functional IL4-589C>T and IL10-1082G>A polymorphisms seem not to be associated with occurrence of ischemic strokes, but may predict ischemic stroke relapses
20880001 Observational study of gene-disease association. (HuGE Navigator)
20859068 STAT6 binding region is required for the IL-4-induced increase in promoter activity of the human RhoA gene
20852371 Results suggest that the functional gene polymorphisms of IL-4 play an important role in the pathogenesis of diabetic nephropathy in patients with type 2 diabetes mellitus.
20852371 Observational study of gene-disease association. (HuGE Navigator)
20839488 Observational study of gene-disease association. (HuGE Navigator)
20814620 Report in vitro propagation and dynamics of T cells from skin biopsies by methods using interleukins-2 and -4 or anti-CD3/CD28 antibody-coated microbeads.
20811626 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20808855 Tumour epithelial FAAH-IR is associated with prostate cancer severity and outcome at mid-range, but not high, CB(1)IR scores.
20736038 short tandem repeat genetic polymorphism is associated with bronchial asthma and atopy in a Swiss cohort study
20736038 Observational study of gene-disease association. (HuGE Navigator)
20726231 The ratio of IFN-gamma/IL-4 in cord blod mononuclear cells could be down-regulated by retinoic acid receptor agonist and retinoid X receptor agonist.
20723894 PPARgamma and Th2 cytokines (IL4, IL10) have roles in low-intensity exercise enhancement of expression of markers of alternative activation in circulating leukocytes
20719954 the IL-4/STAT6 signaling network is precisely controlled by KSHV for survival, maintenance of latency, and suppression of the host cytokine immune response of the virus-infected cells.
20716621 Observational study of gene-disease association. (HuGE Navigator)
20713631 Interleukin-4 increased CD209 expression on human Schwann cells and subsequent Schwann cell binding to Mycobacterium leprae.
20711808 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20703737 Observational study of gene-disease association. (HuGE Navigator)
20673868 Observational study of gene-disease association. (HuGE Navigator)
20644561 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20620947 We showed that STAT6 resided in the core of IL-4-driven transcriptional events in human CD4+ T cells
20618516 results suggest that the IL-4-590 T>C polymorphism is involved in susceptibility to developing renal cell carcinoma in Chinese populations
20618516 Observational study of gene-disease association. (HuGE Navigator)
20603050 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20603037 Observational study of gene-disease association. (HuGE Navigator)
20580039 results suggested that IL-4 promoter polymorphisms are associated with T2DM. A significant association between IL-4 -589 C/C genotype and lower circulatory high-density lipoprotein cholesterol level was observed as well
20580039 Observational study of gene-disease association. (HuGE Navigator)
20568250 Observational study of gene-disease association. (HuGE Navigator)
20565368 Observational study of gene-disease association. (HuGE Navigator)
20536507 Observational study of gene-disease association. (HuGE Navigator)
20533927 Eales disease patients showed significantly higher levels of IL-10 and TNF-alpha, increased IFN-gamma/IL-4 (Th1/Th2) ratio, and lower levels of IL-4 (p < 0.05).
20530519 The results indicate that IL4 and STAT6 genes might be involved in the etiology of systemic lupus erythematosus and potentially increased SLE risk through their interaction effect in Chinese patients
20530519 Observational study of gene-disease association. (HuGE Navigator)
20525402 Observational study of gene-disease association. (HuGE Navigator)
20524005 Nonsignificant differences were observed for the IL-4 promoter polymorphism C589T and the ADAM33 T1 polymorphism between asthmatics and controls.
20517665 The IL4RA Q551R SNP is associated with nonatopic asthma in Slovenian children.
20517665 Observational study of gene-disease association. (HuGE Navigator)
20506498 These results demonstrate that IL-4, through activation of the STAT-6 signaling pathway, is involved in survivin expression levels as well as its localization.
20503287 Observational study of gene-disease association. (HuGE Navigator)
20485362 Observational study of gene-disease association. (HuGE Navigator)
20459687 Observational study of gene-disease association. (HuGE Navigator)
20453000 Observational study of gene-disease association. (HuGE Navigator)
20452482 Observational study of gene-disease association. (HuGE Navigator)
20444155 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20442634 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20424473 Observational study of gene-disease association. (HuGE Navigator)
20418110 Observational study of gene-disease association. (HuGE Navigator)
20416077 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20413987 Observational study of gene-disease association. (HuGE Navigator)
20406299 These data suggest that SOCS1 is not involved in the suppression of LPS-induced TNF-alpha production by IL-4.
20403914 observed association between a low IL-4 producing promoter T-allele and prostate cancer risk, study suggests an antitumor role for IL-4 in prostate cancer
20403914 Observational study of gene-disease association. (HuGE Navigator)
20395963 Observational study of gene-disease association. (HuGE Navigator)
20394509 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20367137 Increased IL-4 is associated with multiple myeloma.
20364398 analyzed the effect of 1154 A/G polymorphism of VEGF and 70 bp VNTR polymorphism of intron 3 in IL-4 genes in coronary heart disease (CHD) patients
20364398 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20349753 Observational study of gene-disease association. (HuGE Navigator)
20349326 Interleukin-4 up-regulates monocyte chemoattractant protein-1 expression in vascular endothelium through NADPH oxidase-mediated generation of reactive oxygen species.
20332709 The interaction of 6-locus from the 5 interleukin genes might confer higher risk for graves'disease and Graves'ophthalmopathy than single risk allele.
20332709 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20305143 Observational study of gene-disease association. (HuGE Navigator)
20304823 IL-4 increases Fc epsilon receptor type I (FcepsilonRI) surface expression in human skin-derived mast cells in vitro.
20299965 Observational study of gene-disease association. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
20222161 Meta-analysis of gene-disease association. (HuGE Navigator)
20219689 Observational study of gene-disease association. (HuGE Navigator)
20217044 Observational study of gene-disease association. (HuGE Navigator)
20213229 Observational study of gene-disease association. (HuGE Navigator)
20192866 Significant associations between ... polymorphisms in the IL4 gene and chronic periodontitis were verified in Brazilian individuals.
20192866 Observational study of gene-disease association. (HuGE Navigator)
20184663 Data show that a significant increase in TAFs for VEGF, TGF-beta1, IL-4, IL-10 and TNFalpha.
20177758 Observational study of gene-disease association. (HuGE Navigator)
20147633 Data from study of Stat6 transgenic mice suggest that IL-4 plays an important role in regulating epidermal homeostasis and innate barrier function.
20145925 Observational study of gene-disease association. (HuGE Navigator)
20140262 Observational study of gene-disease association. (HuGE Navigator)
20139223 OX40/OX40L expression is increased in the bronchial submucosa in mild asthma, but not in moderate-to-severe disease, and is related to the degree of tissue eosinophilia and IL-4 expression.
20128416 association between promoter polymorphisms and asthma in Iranian patients
20121760 an allergen-specific IL-4 response in adult human subjects during allergen-specific sensitization to lab rats, which was quantitatively associated with the development of the specific IgE antibodies
20112007 These results indicated that IL-4 up-regulated histamine H1 receptor (H1R) mRNA level through increased transcription of H1R gene via JAK3-STAT6 pathway
20100010 Results describe the relationship between the expression of IFN-gamma, IL-4, Foxp3 and perforin genes and the methylation status of their promoters in immune thrombocytopenic purpura (ITP) patients.
20093796 both IL-13 and IL-4 caused a significant increase in the levels of phosphorylated STAT1 in bronchial smooth muscle cells
20082482 Observational study of gene-disease association. (HuGE Navigator)
20059579 data show that IL-4 and pro-inflammatory cytokines such as TNF-alpha, IL-1beta and IFN-gamma regulate CCL26 synthesis in human monocytic cells
20056178 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20053586 IL-4 negatively affects an early post-fusion step in the HIV-1 replication cycle.
20049266 Observational study of gene-disease association. (HuGE Navigator)
20039421 1,25(OH)(2)D(3) may contribute its bone-sparing effects in RA patients taking corticosteroids by the modulation of Th17 polarization, inhibition of Th17 cytokines, and stimulation of IL-4.
20030788 Observational study of gene-disease association. (HuGE Navigator)
20027321 Susceptibility to tuberculous infection is associated with C allele and CC and CT genotypes of C-590T polymorphism in the IL4 gene.
20016407 Stduy find an association and linkage of the IL4 -524 and the C1INH 480 polymorphisms with susceptibility to meningococcal infection.
20016407 Observational study of gene-disease association. (HuGE Navigator)
20012528 HIV-1 gp120 induces release of IL-4 in CD4+ T cells
20010912 Differential requirements for IL-4/STAT6 signalling in CD4 T-cell fate determination and Th2-immune effector responses.
20003246 results suggest that IL4-590C or T alleles participated differently in the regulation of anti-malarial antibody isotype profiles in primary and secondary malaria infection and, therefore, could play an important role in alteration of malaria severity.
20003246 Observational study of gene-disease association. (HuGE Navigator)
19959237 The IL-4 -34TT and -590TT genotype has a functional effect on T helper (Th) cells of patients with aggressive periodontitis.
19959237 Observational study of gene-disease association. (HuGE Navigator)
19948975 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and genetic testing. (HuGE Navigator)
19938203 Observational study of gene-disease association. (HuGE Navigator)
19933216 Meta-analysis of gene-disease association. (HuGE Navigator)
19915002 study provides the first evidence that Egr-1 protein is differentially expressed in Th1 and Th2 cells and is involved in the acute phase of the IL-4 transcription in response to TCR stimulation
19913121 Observational study of gene-disease association. (HuGE Navigator)
19910025 SNPs at the IL4 locus that are potentially exclusive to African Americans are associated with susceptibility to asthma.
19910025 Observational study of gene-disease association. (HuGE Navigator)
19892918 Observational study of gene-disease association. (HuGE Navigator)
19882211 Observational study of gene-disease association. (HuGE Navigator)
19878651 redox regulation of IL-4 signaling may occur in the extracellular space by reduction of IL-4 disulfides by cell surface enzymes.
19862939 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19860911 Observational study of gene-disease association. (HuGE Navigator)
19857574 Suggest that IL-4 is capable of inducing an upregulation of RhoA via an activation of STAT6 in cultured bronchial smooth muscle cells resulting in bronchial hyperresponsiveness.
19845895 Observational study of gene-disease association. (HuGE Navigator)
19840389 Observational study of gene-disease association. (HuGE Navigator)
19835477 IL-4 concentrations were higher in children with Cerebral malaria than in children with uncomplicated malaria; the most significant association was between the IL4 variable-number tandem repeat (VNTR) 1/2 genotype and severe disease
19835477 Observational study of gene-disease association. (HuGE Navigator)
19818512 Observational study of gene-disease association. (HuGE Navigator)
19817957 Observational study of gene-disease association. (HuGE Navigator)
19811408 Increase in IL-4 and IL-10 shows induction of TH2 cells in the pathogenesis of autoimmune disorders Pemphigus vulgaris.
19804407 The interplay between Oct-1 and unknown transcription factors may be responsible for the IL-4 C-33T polymorphism effects.
19799628 Upregulation of IL-4 was correlated with a higher parasite burden in early lesions of cutaneous leishmaniasis (CL), which may be involved in the pathogenesis of CL by inhibiting a protective immune response.
19773451 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19773279 Observational study of gene-disease association. (HuGE Navigator)
19772762 the association of IL-4 gene polymorphisms with asthma
19772762 Observational study of gene-disease association. (HuGE Navigator)
19762488 -CSF and IL-4 abolished monocytic differentiation into osteoclasts while inducing dendritic cell differentiation
19753334 IL-4 was found more often in the colostrum of allergic mothers than nonallergic ones.
19735490 The pattern of IFN-gamma and IL-4 cytokine expression by NKT cells varied depending on the type of eczematous disease.
19726720 This study identifies the E-cadherin/catenin complex as a discriminative, partly polyamine-regulated feature of IL-4/IL-13-exposed alternatively activated macrophages
19721012 GATA-1 mediates the repression of VDR and enables IL-4-dependent moDC differentiation.
19718824 The risk of progression, the recurrent course of the infection and its poor outcome is positively associated with the homozygous CC type and C allele in the IL-4 gene C-590T promoter region.
19718656 MUC5AC is upregulated by IL-4 through CREB in human airway epithelial cells
19707465 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19706316 differential modulation of in vitro model of R5-HIV-1 transfer from macrophages towards T cells was demonstrated in vitro according to the relative secretion of IL-4/IL-13 at paracrine level.
19699526 Gal-3 expression in iDCs is restricted, and Gal-3 protein is localized mainly intracellular, due to the opposite actions of IL-4 and GM-CSF.
19698128 Data show that expression of IL-1 Beta, IL-4, IL-5, IL-6 and IL-10 were upregulated in CT-positive infertile women.
19692168 Observational study of gene-disease association. (HuGE Navigator)
19683555 Observational study of gene-disease association. (HuGE Navigator)
19682920 functional genetic variants in the IL-4 promoter could influence the production of IL-4 in Paracoccidioidomycosis.
19682920 Observational study of gene-disease association. (HuGE Navigator)
19657367 Observational study of gene-disease association. (HuGE Navigator)
19625176 Observational study of gene-disease association. (HuGE Navigator)
19621989 HIV-1 gp120 induces release of IL-4 in CD4+ T cells
19594368 Observational study of genotype prevalence. (HuGE Navigator)
19586939 Data show that CD3(+) marrow cells containing TNF-alpha, IFN-gamma and
19586918 the D1 domain of IL-13Ralpha1 acts as an affinity converter, through direct cytokine interactions, that allows the shared receptor to respond differentially to IL-4 and IL-13.
19578876 Observational study of gene-disease association. (HuGE Navigator)
19575932 There was a significant correlation between the polymorphisms of +33C/T sites of IL-4 and +1923C/T sites of IL-13 gene and susceptibility to asthma and increase of the total serum IgE.
19573080 Observational study of gene-disease association. (HuGE Navigator)
19566553 Polymorphisms in IL-6(interleukin-6) or IL-4 (interleukin-4) may act as susceptibility genes, in the presence of viral exposure, for the development of hemiplegic and quadriplegic Cystic Fibrosis
19559392 Observational study of gene-disease association. (HuGE Navigator)
19555572 Observational study of gene-disease association. (HuGE Navigator)
19552791 Low amounts of IFN-gamma and high amounts of IL-4-producing T cells at birth may enhance the risk of subsequent development of atopic dermatitis.
19544973 IL-1RN and IL-4 polymorphisms alone or in combination are not associated with risk of breast cancer in Indian patients
19544973 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19544559 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19541591 IL-4/IL-10 impairs the Th1 protective response and allows the parasite to survive in hydatid patients.
19536153 Observational study of gene-disease association. (HuGE Navigator)
19527514 Observational study of gene-disease association. (HuGE Navigator)
19521787 Chromatin structure and DNA methylation of the IL4 gene in human Th2 cells are reported.
19515749 Observational study of gene-disease association. (HuGE Navigator)
19508433 Observational study of gene-disease association. (HuGE Navigator)
19505916 Observational study of gene-disease association. (HuGE Navigator)
19497039 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19495883 Observational study of gene-disease association. (HuGE Navigator)
19479237 Observational study of gene-disease association. (HuGE Navigator)
19470040 Observational study of gene-disease association. (HuGE Navigator)
19437232 not significantly elevated in Sudanese women with preeclampsia
19426601 Data show that camel milk regulates the expression of Th1/Th2 cytokines, IL-4 and IFN-gamma, which could strengthen the cellular immune response, inhibit the replication of virus DNA, and promote the recovery of the chronic hepatitis B patients.
19421745 Observational study of gene-disease association. (HuGE Navigator)
19419769 The IL-4-induced downregulatory effect on Weibel-Palade bodies component genes depended on the negative feedback regulation by SOCS-1 induced by STAT6 signaling.
19409508 results indicate that the impact of IL-4 -590 variants on antibody levels may vary in different ethnic populations, and that this might affect the Ig-class and subclass distributions.
19409508 Observational study of gene-disease association. (HuGE Navigator)
19408823 Observational study of genotype prevalence. (HuGE Navigator)
19385959 The function of FcepsilonRI on respiratory tract dendritic cells (RTDC) from patients with rhinosinusitis is susceptible to counter regulation by IL-4 and IL-10.
19382262 Observational study of gene-disease association. (HuGE Navigator)
19375306 Meta-analysis of gene-disease association. (HuGE Navigator)
19372547 Overexpression of interleukin 4 is associated with liver metastases in rhabdomyosarcoma.
19370405 oral lichen planus patients showed a low-level IFN-gamma but high-level IL-4 expression profile in saliva
19351467 The gene polymorphisms of CYP2E1, CYP1A1, IL-4 are probably associated with susceptibility for trichloroethylene-induced medicamentosa-like dermatitis.
19351467 Observational study of gene-disease association. (HuGE Navigator)
19347053 Observational study of gene-disease association. (HuGE Navigator)
19336370 Observational study of gene-disease association. (HuGE Navigator)
19332998 IL-13/IL-4 and TLR-10 might be involved in the genetics of preterm births.
19332120 Observational study of gene-disease association. (HuGE Navigator)
19279357 IL-4 polymorphisms were found to be both positively (susceptible) and negatively (protective) associated with chronic obstructive pulmonary disease in Macedonians.
19275586 HIV-1 gp120 induces release of IL-4 in CD4+ T cells
19264973 Observational study of gene-disease association. (HuGE Navigator)
19263529 Observational study of gene-disease association. (HuGE Navigator)
19262574 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19261373 Women with a history of recurring vulvovaginal candidosis and currently symptomatic had elevated concentrations of IL-4, PgE(2), and candida-specific IgE in their vaginal fluids compared to women with no clinical symptoms.
19258923 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19254294 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19251840 These novel findings identify a Th2 cytokine-driven homeostatic feedback mechanism in airway smooth muscle that enhances its responsiveness to endogenous glucocorticoids by upregulating 11beta-HSD1 activity.
19249119 association of gene promoter polymorphisms with common variable immunodeficiency
19249119 Observational study of gene-disease association. (HuGE Navigator)
19247692 Observational study of gene-disease association. (HuGE Navigator)
19222422 Observational study of gene-disease association. (HuGE Navigator)
19200845 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19193442 CD21-dependent viral entry plays a crucial role in type 2 alveolar epithelial cells, indicative of an IL-4 response EBV infection in idiopathic pulmonary fibrosis.
19190772 The polymorphisms of IFN-gamma , IL-13 and IL-4 do not by themselves confer resistance or susceptibility to Schistosoma mansoni reinfection, but these genotypes allow the resistant phenotype to be developed and expressed upon suitable immune exposure.
19190772 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19185507 Our results do not support the hypothesis that the analyzed polymorphisms confer differences in alcoholic liver cirrhosis or alcohol use disorders susceptibility.
19185507 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19170196 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19169254 Expanded catalog of genetic loci implicated in psoriasis susceptibility.
19168731 RgpA-Kgp proteinase-adhesin complexes of Prophyromonas gingivalis degrade Th2 cytokines IL-4 and IL-5 and reduce their bioavailability in T cell lines.
19164348 mast cells are able to store TSLP intracellularly and to produce TSLP following aggregation of FcepsilonRI in the presence of IL-4
19141349 increased secretion by peripheral blood T cells in patients with eosinophilic gastroenteritis
19131662 Meta-analysis of gene-disease association. (HuGE Navigator)
19131452 Observational study of gene-disease association. (HuGE Navigator)
19129082 No significant differences in either the genotype distribution or allele frequencies of IL4, CCR5 and ACE gene polymorphisms were observed in vitiligo.
19129082 Observational study of gene-disease association. (HuGE Navigator)
19126646 Observational study of gene-disease association. (HuGE Navigator)
19122650 augmented production of HA and the decreased E-cadherin expression by keratinocytes stimulated with IL-4/IL-13 or IFN-gamma cause spongiosis in acute eczema
19117745 Observational study of gene-disease association. (HuGE Navigator)
19116009 Pre-treatment with IL-4 and IL-13, but not IFN-gamma, induced desensitization of the human airway smooth muscle cells to IL-13 as measured by eotaxin secretion and calcium transients to histamine.
19074885 Observational study of gene-disease association. (HuGE Navigator)
19066394 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19058839 House dust mite-sensitive DCs exposed to Der p 1 downregulated IDO activity and tipped the T(H)1/T(H)2 cytokine balance toward IL-4, resulting in sustainable IDO suppression.
19058298 results indicate that IL4 T-168C and IL2 G-330T promoter polymorphisms may contribute to the etiology of gastric cardia cancer in Chinese populations
19058298 Observational study of gene-disease association. (HuGE Navigator)
19050632 Observational study of gene-disease association. (HuGE Navigator)
19028820 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19019335 Observational study of gene-disease association. (HuGE Navigator)
19013323 HIV-1 gp120 induces release of IL-4 in CD4+ T cells
19008611 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18974840 Observational study of gene-disease association. (HuGE Navigator)
18974110 findings were helpful to understand the long clinical observation and revealed that endogenous IL-4, the product of host immune response, can be used by tumor cells to facilitate their growth
18971305 Significant genotypic and allelic associations were observed between interleukin 1alpha (IL-1alpha) -889-C/T, IL-4 -1098-G/T and -590-C/T, and IL-6 -174-G/C polymorphisms and osteomyelitis in the Greek population.
18971305 Observational study of gene-disease association. (HuGE Navigator)
18971287 CCL11 induces SOCS1 and SOCS3 expression in murine macrophages, human monocytes, and dendritic cells and inhibits GM-CSF-mediated STAT5 activation and IL-4-induced STAT6 activation in a range of hematopoietic cells.
18955794 interleukin-4 and amphiregulin have roles in the proliferation of human airway smooth muscle cells and cytokine release
18941246 Study of pathways engaged in transgenic model of thymic stromal lymphopoietin-driven airway inflammation demonstrates that simultaneous blockade of interleukin (IL)-4 and IL-13 can reverse established asthma-like chronic airway disease.
18936436 Observational study of genotype prevalence. (HuGE Navigator)
18931892 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18927306 Observational study of gene-disease association. (HuGE Navigator)
18924208 Th2 cell cytokine IL-4 decisively determines the phenotype of ongoing immune responses by orchestrating the functional phenotype of newly immigrating DC precursors.
18834248 Haplotype T(-590)/T(-33)/allele 2 VNTR of IL-4 gene was significantly more frequent in CP patients. The 3 polymorphisms in IL-4 gene act in a cooperative fashion and suggest the high-production IL-4 haplotype was associated with an increased risk for CP.
18834248 Observational study of gene-disease association. (HuGE Navigator)
18818748 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18781131 Observational study of gene-disease association. (HuGE Navigator)
18776133 combination IL-2/IL-4 inhibits GCRalpha nuclear translocation in human T cells, and this effect is reversed by IFN-gamma via inhibition of p38 MAPK activation.
18716132 IL-4 induces PTP1B mRNA expression in a phosphatidylinositol 3-kinase-dependent manner and enhances PTP1B protein stability to suppress IL-4-induced STAT6 signaling.
18708672 Observational study of gene-disease association. (HuGE Navigator)
18696265 the RANTES G-403A allele increased the relative risk for cerebral infarction in the subjects without the IL-4 VNTR allele 3
18696265 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18694328 There was no significant association of IL-4 and IL-6 gene polymorphisms with the risk of prostate cancer, however, an IL-6 gene variant may be associated with prostate progression and bone metastasis.
18694328 Observational study of gene-disease association. (HuGE Navigator)
18688110 Both IL-4 and IL-1RN (VNTR) gene polymorphisms were significantly associated with T2DM subjects. This may suggest that the genetic polymorphisms of IL-4 and IL-1RN genes could serve as susceptibility indicators for T2DM in the Indian population.
18688110 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18682601 The follicular lymphoma microenvironment contains increased levels of IL-4, with prominent tumor basal phosphorylation of Erk.
18676870 Observational study of gene-disease association. (HuGE Navigator)
18676680 Observational study of gene-disease association. (HuGE Navigator)
18674658 Observational study of gene-disease association. (HuGE Navigator)
18662263 that the IL-4 haplotype tagged by the -589T allele reduces the risk of MI in young individuals
18662263 Observational study of gene-disease association. (HuGE Navigator)
18651887 there was a marked trend for an association between the IL-4 -590 (C>T) SNP and pre-eclampsia (chi(2)= 5.87, P = 0.055), with a prevalence of TT homozygous women in this group (OR 4.455, 95% CI 1.286-15.350).
18641314 dynamic interplay between IL-4 and IL-21 in regulating the production of IgG subclasses and IgA
18636124 Observational study of gene-disease association. (HuGE Navigator)
18635180 HBD-2 and HD-5 may be involved in defending against invasion by BV-related microorganisms and the decrease in IL-4 concentration may increase susceptibility to bacterial vaginosis
18633131 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18632425 Observational study of genotype prevalence. (HuGE Navigator)
18629290 Observational study of gene-disease association. (HuGE Navigator)
18628242 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18626468 IL-4 exerts profibrotic effects by activating hIHFs and inducing collagen production and secretion
18625055 There is a lack of association or interactions between the IL-4, IL-4Ralpha and IL-13 genes, and rheumatoid arthritis.
18625055 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18624944 concentration decreased from periodontal health to disease
18614592 The concentrations of these cytokines [interferon-gamma (IFN-gamma), interleukin-4 (IL-4) and IL-10]were significantly higher in peripheral, placental sera from uninfected women than in sera from infected women.
18610832 Observational study of gene-disease association. (HuGE Navigator)
18610831 Observational study of gene-disease association. (HuGE Navigator)
18599603 proliferation of endometriotic stromal cells induced by locally produced IL-4 is involved in the development of endometriosis.
18597704 Serum IL-4 appears to be an early marker of immunological response to sublingual immunotherapy.
18596736 mechanisms by which IL-4 mediated cell cycle progression in T-ALL cells
18593330 polymorphism has influence on oral lichen planus disease susceptibility and progression in Chinese population
18593330 Observational study of gene-disease association. (HuGE Navigator)
18574615 Data show that there is no significant association of IL-4 gene with schizophrenia in Japanese population using either single marker or haplotype analyses.
18574615 Observational study of gene-disease association. (HuGE Navigator)
18568476 studied the expression of IL-1beta, IL-4, and IL-8 in the gingival crevicular fluid (GCF) of children, adolescents, and young adults with and without fixed orthodontic appliances
18568448 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18566561 There was no difference in relation to IL-2 and IL-4 promoter polymorphism influencing renal allograft survival.
18566561 Observational study of gene-disease association. (HuGE Navigator)
18558283 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18547691 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18538381 Observational study of gene-disease association. (HuGE Navigator)
18533937 There was no significant difference in IL-4/beta-actin between the patients with AIH and the healthy controls. In contrast there was a significant difference of IFN-gamma/beta-actin between those two groups.
18522869 Observational study of gene-disease association. (HuGE Navigator)
18497474 IL-13 attenuates EC viability by inducing apoptosis, and STAT6 plays pivotal roles on IL-13- and IL-4-induced apoptosis in ECs.
18485518 IL-10, IL-4 and TNF-alpha genetic polymorphisms were not related to the risk of developing drug induced liver injury
18485518 Observational study of gene-disease association. (HuGE Navigator)
18476609 The expression of IL-4 and the activity of p50 was increased significantly in nasal polyps.
18455629 IL-4 gene polymorphism is associated with the risk of BPH
18455629 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18454680 Observational study of gene-disease association. (HuGE Navigator)
18448485 the SNPs IL4-590 and IL6-174 may be useful markers for colorectal cancer prognosis
18448485 Observational study of gene-disease association. (HuGE Navigator)
18441098 activation of the TRPM8 variant in human lung epithelial cells leads to increased expression of IL-1alpha, -1beta, -4, -6, -8, and -13, granulocyte-macrophage colony-stimulating factor (GM-CSF), and TNF-alpha.
18439079 IL-4 intron 3 VNTR and IL-6 (-174) G/C variants reflect ethnic variation.
18439079 Observational study of genotype prevalence. (HuGE Navigator)
18433468 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18425216 Observational study of gene-disease association. (HuGE Navigator)
18422436 Observational study of gene-disease association. (HuGE Navigator)
18418228 patients with multivessel coronary artery disease had a higher periprocedure(percutaneous coronary angioplasty) ratio of IL-4(interleukin 4) than those with single-vessel coronary artery disease
18410779 African-American infants exposed to environmental tobacco smoke having interleukin 4 C-589T polymorphism were at increased risk of wheezing.
18410779 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18403443 Human bronchial smooth muscle cells contain functional BK(Ca) channels whose activity is rapidly potentiated by the cytokine, IL-4, but not by IL-13.
18396027 This meta-analysis suggests there may be an important effect of single nucleotide polymorphisms (SNPs) in the promoter region of IL-4 gene on the pathogenesis of atopic asthma.
18396027 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
18394346 The expression of IL-4 mRNA in the recurrent warts was higher than in non-recurrent warts
18389618 Association with clinical course of the disease (typical form) was obtained for 150V polymorphism of IL4RA gene and for F/f polymorphism of VDR gene (p = 0.001 and p = 0.009, respectively).
18389618 Observational study of gene-disease association. (HuGE Navigator)
18385759 S100/A11 is significantly downregulated in the presence of IL-4 and IL-13.
18371377 These data suggest that colon tumor growth is dictated by stem-like cells that are treatment resistant due to the autocrine production of IL-4.
18351434 The stepwise analyses showed that IL-4 was the biomarker in exhaled breath condensate which contributed most to the discrimination between controls and systemic sclerosis patients.
18342537 Data show that IL-4-induced Stat6 activities affect apoptosis and gene expression in breast cancer cells.
18322173 A model is proposed that involves cooperative binding of IL-4 to monocyte cell surface dermatan sulfate (CSB), facilitating an important role of glycosaminoglycans in the IL-4-driven differentiation of monocytes into dendritic cells.
18310157 The -590CC genotype in the IL4 gene is a strong predictive factor for the development of hypothyroidism in Hashimoto disease.
18295676 Results suggest that IL-4 -590 C/T and 8375 A/G SNPs do not confer a relevant role in the susceptibility of Kawasaki disease or coronary artery lesions development in Taiwanese children.
18295676 Observational study of gene-disease association. (HuGE Navigator)
18294957 These findings, together with the observation of constitutive Stat6 activation in many human malignancies, suggest that Stat6 activities could be a biomarker for cancer cell's invasive/metastatic capability.
18286287 TNF-alpha-positive cells are more frequent, while IL-4-positive cells are less frequent in tissues from lung neoplasms
18276105 Data show that depressed and anxious mood were both associated with significantly lower ratios of polyclonally-stimulated CD4 and CD8 (+) cells producing IFN gamma (TH(1) cells) vs. IL-4 (TH(2) cells)in ovarian cancer patients.
18273643 IL-4 polymorphism was not a primary predictor of oral squamous cell carcinoma development
18273643 Observational study of gene-disease association. (HuGE Navigator)
18273035 Observational study of gene-disease association. (HuGE Navigator)
18263811 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18251702 IL-4 and IL-13 induced osteoprotegerin(OPG) expression through activation of STAT6 in endothelial cells, and HUVEC-derived OPG is an IL-4/IL-13-induced inhibitor of osteoclastic resorption
18243101 Molecular and structural basis of cytokine receptor pleiotropy in the interleukin-4/13 system are reported.
18239807 Observational study of gene-disease association. (HuGE Navigator)
18239807 The risk of progression and chronic course of viral hepatitides in Caucasian population was associated with T/T genotype of the polymorphic region C590T in the IL-4 gene.
18230112 The results suggest that the interleukin-4 (C-590T) and interferon-gamma (G5644A) gene polymorphisms may not be associated with the susceptibility of Iranian individuals to periodontitis.
18230112 Observational study of gene-disease association. (HuGE Navigator)
18211631 Specific cytokines (IL-1alpha, IL-4, and IL-6) are acutely elevated during hyperglycemia in children with type 1 diabetes, and these elevations persist for hours after hyperglycemia has been corrected.
18210751 Observational study of gene-disease association. (HuGE Navigator)
18210751 IL-4 gene expression-related polymorphism is associated with the development of initial stages of colorectal cancer, while in advanced stages IL-4 levels appear to be less important
18206261 Downregulation of E6 and E7 levels by IL-4 in CaSki cells is weaker than that exerted by TGF-beta1, a known LCR inhibitor.
18204280 IL-4 and IL-13 potently induce fibroblast growth factor 2-primed bronchial smooth muscle cell (BSMC)proliferation; could have a potential role in BSMC hyperplasia.
18202702 IL-4 acts as an autocrine survival factor in epithelial cells. Results indicate that inhibition of IL-4/IL-4R signaling may serve as a novel treatment for epithelial cancers.
18179773 IL-4 and IL-4RA gene polymorphisms concur in selecting the H. pylori infecting strain, probably influencing the IL-4 signalling pathway
18179773 Observational study of gene-disease association. (HuGE Navigator)
18179754 gastric epithelial cells might regulate the balance between tolerance and immune response by the fine tuning of IL-4 and IL-4delta2 expression
18174230 Observational study of gene-disease association. (HuGE Navigator)
18165865 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18156980 Observational study of gene-disease association. (HuGE Navigator)
18088017 Observational study of gene-disease association. (HuGE Navigator)
18088017 role of TNF-alpha-308 G/A and IL-4-589 C/T polymorphisms in susceptibility to and severity of asthma.
18064451 Location of IL4 in the 5q31-33 complex genetic region requires cautious interpretation of previous IL4-association studies, since 5q31 contains many genes involved in immunological responses, and prior linkage disequilibrium data may be misleading.
18064451 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18058260 Observational study of gene-disease association. (HuGE Navigator)
18058260 IL-4 gene polymorphisms that arise at either intron 3 or promoter -590 positions are not suitable genetic markers for autoimmune diseases of the thyroid gland among Taiwanese Chinese.
18056382 Observational study of gene-disease association. (HuGE Navigator)
18042256 production of human interleukin-10 (IL-10) and IL-4 partially contributed to HSV-1-induced KSHV replication.
18031948 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18031948 we studied the association of variants in IL-4 (C-589T, G3017T) and IL-4R alpha (Gln576Arg) with allergies and with risk of pancreatic cancer
18008330 IL-4 plays an important role in promoting androgen-independent prostate cancer growth
17968425 IL-4 suppressed the activation of caspases 9 and 3, and, in contrast to previous reports, induced the phosphorylation (deactivation) of BAD.
17961771 The ratio of IL-4delta2 to IL-4 mRNA expression may play a role in disease severity for pulmonary tuberculosis patients. From our observations IL-4 mRNA expression was attenuated in patients with pulmonary infection, either tuberculosis or pneumonia.
17938902 Observational study of genotype prevalence. (HuGE Navigator)
17937745 Observational study of gene-disease association. (HuGE Navigator)
17916900 Observational study of gene-disease association. (HuGE Navigator)
17916404 The results indicated that IL-4-treated LS174T cells are able to produce mucins with a higher degree of O-glycosylation than untreated counterparts.
17914408 Observational study of gene-disease association. (HuGE Navigator)
17908769 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17889143 Observational study of gene-disease association. (HuGE Navigator)
17882904 Interleukin-4 may modulate the expression of chloride channel protein CLC-2 and CLC-3 in chronic rhinosinusitis without nasal polyps.
17855802 Observational study of gene-disease association. (HuGE Navigator)
17855802 Interleukin 4 promoter polymorphism may be contribute to the genetic predisposition and to the pathogenesis in MS.
17851828 Observational study of gene-disease association. (HuGE Navigator)
17851828 polymorphisms were not related to severe generalized chronic periodontitis in a Turkish population
17714919 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17714919 -590*C allele significantly increased in Korean psoriasis patients, especially late-onset group
17703412 Observational study of gene-disease association. (HuGE Navigator)
17678726 Observational study of gene-disease association. (HuGE Navigator)
17662651 Results report that interleukin-4 (IL-4) induced the expression of 15-LO-1 in human cord blood derived mast cells (CBMC).
17656331 Observational study of gene-disease association. (HuGE Navigator)
17655693 Observational study of gene-disease association. (HuGE Navigator)
17655693 the interferon-gamma +874(A/T) and IL-4 VNTR in intron3 polymorphisms are not responsible for genetic susceptibility to ITP
17653830 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17644317 S100A8 is regulated by IL-17, dexamethasone, IL-4 and IL-13 in HaCat cells (human keratinocyte cell line)
17640674 IL-4 and interferon gamma have opposite effects on the expression of claudin-2 and the physiology of the tight junction
17640324 Observational study of gene-disease association. (HuGE Navigator)
17631734 Observational study of gene-disease association. (HuGE Navigator)
17631734 Polymorphisms of the IL-4 (promoter-590 and intron 3) and TNF-alpha promoter-308 genes are not related to gout in Chinese patients in Taiwan.
17627763 Observational study of genotype prevalence. (HuGE Navigator)
17623648 ST2 reduced production of IL-4, IL-5, and IL-13 from IL-33-stimulated splenocytes. These results indicate that soluble ST2 acts as a negative regulator of Th2 cytokine production by the IL-33 signaling.
17576577 There was no evidence of a statistically significant association in the allelic distribution of IL4, IL10, IL16 and TNF polymorphism that were tested,nor in the haplotype frequencies in patietns with CD.
17566759 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17566759 Data suggest that individuals who have IFN-gammaAA genotype are more susceptible, and those who carry IL-4CC genotype are more resistant to brucellosis.
17563406 Levels of serum IL-4 was considerably higher in asthmatics than non-asthmatic controls
17548690 Observational study of gene-disease association. (HuGE Navigator)
17548690 IL4 and IL4R polymorphisms and haplotypes were neither significantly associated with IgE levels in controls nor associated with glioma status
17541280 The inducible mRNA expression and the promoter activity of IL-4 were significantly diminished by ectopic expression of T-bet.
17540990 Neither IL-4 genotype nor the serum levels seem to play any role in recovery from coronary artery bypass surgery.
17540990 Observational study of gene-disease association. (HuGE Navigator)
17536219 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17530998 Observational study of gene-disease association. (HuGE Navigator)
17524861 Observational study of gene-disease association. (HuGE Navigator)
17524861 Some cytokine gene alleles reflecte stable graft function among kidney transplant recipients.
17523428 Observational study of gene-disease association. (HuGE Navigator)
17460561 IL-4 expression is elevated in severe recurrent hepatitis C and may play a role in the progression of hepatic lesions after liver transplantation.
17454884 Observational study of gene-disease association. (HuGE Navigator)
17451413 Observational study of gene-disease association. (HuGE Navigator)
17451413 study demonstrated an association between the IL-4 -590 T/T and IL-4 -34 T/T genotypes and aggressive periodontitis
17444864 Observational study of gene-disease association. (HuGE Navigator)
17433443 IL-4 induces dose-dependent early activation of extracellular signal-regulated kinase (Erk)/Akt kinase as well as STAT6 in Jurkat T cells.
17428692 Observational study of gene-disease association. (HuGE Navigator)
17428692 the IL4 T/T genotype was associated with an increased risk for the development of oral squamous cell carcinoma (P = .018; OR 1.47, 95% CI 0.66-3.28), especially for early stages of this malignancy
17420820 Observational study of gene-disease association. (HuGE Navigator)
17420820 IL4+33 and IL4R*Q551 polymorphisms may have a promoting role of TH2 mediators in African MS descendants. IL4 and IL4R genes are susceptibility factors for Brazilian MS but may be able to modify ethnicity-dependent disease risk and penetrance.
17405833 Observational study of gene-disease association. (HuGE Navigator)
17405833 The Single Nucleotide Polymorphisms tested in this study within the region coding for IL-4 fail to show significant associations with susceptibility to IIM disease.
17389870 study highlights protective role of IL-4 during S. aureus corneal infection
17389011 the duplicitous effects of IL-4 on tumour immunity depend on the type of effector cell (adaptive/innate) mediating tumour clearance and whether tumour growth depends on stromal infrastructure [review]
17388919 Observational study of gene-disease association. (HuGE Navigator)
17379175 Observational study of gene-disease association. (HuGE Navigator)
17379175 IL4-590 C/T polymorphism may play a role in the balance between IL4 and IFN-gamma, as well as in the control of parasitemia, which in turn may alter the severity of malaria
17371990 Collectively, these data suggest a link between the inducible phenotype of CCL23 expression in monocytes by the prototype Th2 molecule pair IL-4/STAT6 and the increased number of CCL23-expressing cells in skin of atopic dermatitis patients.
17369174 Data showed that the frequencies of IL-4 (T-1098) alleles are more than 0.95.
17369174 Observational study of genotype prevalence. (HuGE Navigator)
17355643 Observational study of genotype prevalence. (HuGE Navigator)
17327605 Observational study of gene-disease association. (HuGE Navigator)
17311314 IL4-induced FBGC are characterized by the expression of alphaMbeta2, alphaXbeta2, alpha5beta1, alphaVbeta1, alpha2beta1, and alpha3beta1, which indicates potential interactions with fragments of C3, fibrin(ogen), fibronectin, Factor X, and vitronectin
17309781 Observational study of gene-disease association. (HuGE Navigator)
17309781 the gene polymorphisms of the promotor region of IL-4 at position (-1098) and (-33) are likely to play a pathogenic role in idiopathic pulmonary fibrosis and in modification of its clinical presentation and severity
17303923 Observational study of gene-disease association. (HuGE Navigator)
17303923 an influence of genetic variability at the promoter of IL-4 gene (-590C>T) and a coding region of IL-13 gene (R130Q) on the occurrence of allergic asthma and no relationship between IL-16 promoter polymorphism (-295T>C) and this disease.
17303794 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17299718 Tuberculosis BCG vaccine did not affect mRNA expression.
17295710 Observational study of gene-disease association. (HuGE Navigator)
17291854 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17284225 Observational study of gene-disease association. (HuGE Navigator)
17257312 Observational study of genotype prevalence. (HuGE Navigator)
17237413 TLR-activated DCs inhibit early IL-4 production by CD4 T cells and thus inhibit their ability to subsequently increase GATA-3 expression and commit to the Th2 lineage
17222831 Observational study of gene-disease association. (HuGE Navigator)
17213232 Observational study of gene-disease association. (HuGE Navigator)
17209513 Observational study of gene-disease association. (HuGE Navigator)
17208210 Observational study of gene-disease association. (HuGE Navigator)
17207024 Observational study of gene-disease association. (HuGE Navigator)
17207024 Polymorphism in the promoter of the IL-4 gene is associated with asthma and is a disease modifier in terms of the severity of AHR.
17203290 Observational study of gene-disease association. (HuGE Navigator)
17203290 higher risk in ESRD patients with low IL-4 and high IL-6 producing genotypes
17177148 Observational study of gene-disease association. (HuGE Navigator)
17159260 Observational study of gene-disease association. (HuGE Navigator)
17152005 Observational study of gene-disease association. (HuGE Navigator)
17151939 HIV-1 gp120 induces release of IL-4 in CD4+ T cells
17151125 HIV-1 gp120 induces release of IL-4 in CD4+ T cells
17148075 Observational study of gene-disease association. (HuGE Navigator)
17148075 findings demonstrate for the first time an association between IL-4 590 promoter polymorphism and contracting brucellosis in the Iranian population
17143971 Observational study of gene-disease association. (HuGE Navigator)
17143971 Our findings of higher frequency of IL4 and IL4RA genotypes and alleles with rheumatoid arthritis.
17141086 It's suggested that the IL-4 promoter polymorphism -590 C/C is associated with the expression of 5-LO in the patients with nasal polyp.
17133536 Observational study of gene-disease association. (HuGE Navigator)
17121586 Observational study of gene-disease association. (HuGE Navigator)
17117487 There is an association between expression of Th1/Th2 transcription factors and cytokines (T-bet, GATA-3, IFN-gamma, IL-4,IL-18) in systemic lupus erythematosus.
17097641 IL-4 induced up-regulation of HIF-1alpha gene transcription and the PI3K signaling pathway
17063753 Observational study of gene-disease association. (HuGE Navigator)
17063753 IL4 polymorphism is associated with protection against nasal polyps in a Korean population.
17015735 study of link between SWA-specific Th2 cytokines IL4 and IL5 responsiveness and subsequent increases in worm-IgE, and age factors
17015714 expression of CXCR5 identifies a unique subset of Vgamma9Vdelta2 T cells which express the costimulatory molecules ICOS and CD40L, secrete IL-2, IL-4, and IL-10 and help B cells for Ab production
17014622 Observational study of gene-disease association. (HuGE Navigator)
17006724 Observational study of gene-disease association. (HuGE Navigator)
17006724 The IL4 C-590T polymorphism was not associated with risk of any stage of premaligant lesions, except for a slight, statistically insignificant inverse association of the C allele with dysplasia.
16987060 Both IL-4 and IL-13 inhibited the expression of CXCR4, in contrast to CCR5, which was inhibited by IL-13 alone.
16973957 A significant increase in circulating Vdelta1 T lymphocytes producing interleukin-4 (IL-4) was found in patients with FL, MT, and MZ NHL, at variance with DLCL and HR B-CLL
16950634 Observational study of gene-disease association. (HuGE Navigator)
16938461 Observational study of gene-disease association. (HuGE Navigator)
16931887 Observational study of gene-disease association. (HuGE Navigator)
16931887 The possible role of the polymorphisms in IL-4 gene promoters (C-33T, C-590T and G-1098T) in modulating allergic response and asthma in the Russian population, was studied.
16930576 IL-4 up-regulates mitochondrial adenine nucleotide translocase (ANT)3 in human T cells.
16929824 IL-4 is a key cytokine in nasal polyps with positive allergic skin test.
16916659 Observational study of gene-disease association. (HuGE Navigator)
16914241 Observational study of gene-disease association. (HuGE Navigator)
16877367 Activation of STAT6 appears to be a key factor in P-selectin expression induced by substance P and IL-4 because treatment with STAT6 decoy oligodeoxynucleotides significantly inhibited P-selectin expression.
16867043 Observational study of gene-disease association. (HuGE Navigator)
16864907 M. bovis BCG-infected human epithelial cells can have an active role in a local inflammatory immune response via the secretion of IL-4, CXCL-8 and CXCL-10, which can be selectively regulated by Th2-derived cytokines
16810739 Induces production of CCL17/thymus- and activation-regulated chemokine (TARC) in human T-cells.
16759385 Observational study of gene-disease association. (HuGE Navigator)
16750993 Mast cells from the human mast cell line HMC-1 express IL-4 delta 2 isoform, an alternative splice variant of human IL-4.
16750991 Observational study of gene-disease association. (HuGE Navigator)
16722389 NFKB, IL4 and IL5 expression levels are elevated in T cells from allergic rhinitis patients.
16720107 Observational study of gene-disease association. (HuGE Navigator)
16707627 A(2B) receptors up-regulate IL-4 through G(q) signaling that is potentiated via cross-talk with G(s)-coupled pathways.
16702372 Observational study of gene-disease association. (HuGE Navigator)
16690518 sIL-2R and IL-6, but not IL-2, IL-4, or IL-10, may have a role in preventing progression of aggressive non-Hodgkin's lymphoma
16681592 Observational study of gene-disease association. (HuGE Navigator)
16640778 A structure/function analysis of the IL-4 ligand-receptor interaction, using various mutations of both the ligand and the receptor, is reported.
16601843 IL-4 has differential effects in coronary artery smooth muscle cells: short-term exposure enhances OPG production through a STAT6-dependent mechanism, but long-term exposure causes Cbfa1-dependent osteogenic transformation and decreased production of OPG
16596275 ROC analysis demonstrated that the ratio of IL-5/IL-4 was the most sensitive parameter associated with acute graft-versus-host disease.
16574063 IL-4 has the capacity to inhibit COX-2 mRNA transcription in NSCLC cells and the inhibition of PGE(2) appears to be predominately COX-2 dependent.
16573560 Observational study of gene-disease association. (HuGE Navigator)
16551465 Observational study of gene-disease association. (HuGE Navigator)
16551465 This is the first demonstration of sex-specific association of the two foremost genes of the IL-4 signalling cascade with chronic inflammatory arthropathies.
16547693 Observational study of gene-disease association. (HuGE Navigator)
16547227 HIV-1 gp120 induces release of IL-4 in CD4+ T cells
16544245 Observational study of gene-disease association. (HuGE Navigator)
16522370 Data show strong expression of interleukins (IL)-4, IL-10, and IL-13 in different non-leukocytic cell types, especially in endothelial and epithelial cells in the rat, with strong similarity of expresion in humans.
16520888 Observational study of gene-disease association. (HuGE Navigator)
16511411 Observational study of gene-disease association. (HuGE Navigator)
16492782 a cytokine receptor, the IL-4 receptor alpha chain, mediates eotaxin-stimulated mobilization of preformed IL-4 from eosinophil granules into secretory vesicles
16487180 Observational study of gene-disease association. (HuGE Navigator)
16466711 IL-4 is identified as a pro-migratory agent for myogenic cells by a mechanism which partly explains the demonstrated activity of IL-4 during differentiation.
16461126 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16461126 The interaction between SNPs in IL-4/IL-13 pathway significantly influence genetic control of serum IgE levels and development of childhood asthma.
16449530 Observational study of gene-disease association. (HuGE Navigator)
16429733 Dexamethasone, budesonide and desloratadine all had inhibitory effects on IL-4 release from mast cells.
16429138 HIV-1 gp120 induces release of IL-4 in CD4+ T cells
16427155 HIV p17 was able to counteract the anti-inflammatory effects of IL-4 on the TNF-alpha and IFN-gamma production in IL-15 stimulated monocytes
16427155 HIV-1 gp120 induces release of IL-4 in CD4+ T cells
16403098 Observational study of gene-disease association. (HuGE Navigator)
16388492 Observational study of gene-disease association. (HuGE Navigator)
16388492 Certain IL-13/l4 haplotypes associated with severe Respiratory Syncytial virus infection.
16387595 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16380445 Observational study of gene-disease association. (HuGE Navigator)
16375755 HIV-1 gp120 induces release of IL-4 in CD4+ T cells
16334248 IL-4 plays a very important role in both pathogenesis of allergic rhinitis and desensitization therapy.
16315031 Observational study of gene-disease association. (HuGE Navigator)
16313681 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16313303 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16301860 Meta-analysis and HuGE review of gene-disease association, gene-gene interaction, and healthcare-related. (HuGE Navigator)
16289646 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16249002 pro-inflammatory and pro-atherogenic effect of IL-4 in vascular tissues
16232344 Observational study of gene-disease association. (HuGE Navigator)
16230423 Observational study of gene-disease association. (HuGE Navigator)
16215326 Observational study of gene-disease association. (HuGE Navigator)
16215326 In females the TLR4 and IL4 genes show an epistatic effect on the risk of asthma.
16195814 Observational study of gene-disease association. (HuGE Navigator)
16193177 Observational study of gene-disease association. (HuGE Navigator)
16190985 intracellular vesicular system mediates the rapid mobilization and secretion of preformed IL-4 by activated eosinophils
16184405 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16166103 Observational study of gene-disease association. (HuGE Navigator)
16164695 Observational study of genotype prevalence. (HuGE Navigator)
16100774 Observational study of genotype prevalence. (HuGE Navigator)
16091861 Observational study of gene-disease association. (HuGE Navigator)
16091861 a significant association of the IL-2 -330 TT genotype and of the IL-4 -590 CC genotype with schizophrenia could be identified
16083600 Observational study of genotype prevalence. (HuGE Navigator)
16083175 Observational study of gene-disease association. (HuGE Navigator)
16053729 Data show the significance of polymorphisms in variable number of tandem repeat region of IL-4 gene in recurrence of childhood steroid sensitive nephrotic syndrome.
16053729 Observational study of gene-disease association. (HuGE Navigator)
16046318 Observational study of gene-disease association. (HuGE Navigator)
16044136 IL-4 is expressed on CD8(+) T cells and may have a role in chronic graft-versus-host disease
16043936 Observational study of gene-disease association. (HuGE Navigator)
16034134 Human IL-4 protects porcine endothelial cells from the cytotoxic effects of human complement via activation of the phosphatidylinositide 3-kinase/Akt signaling pathway
16004996 IL-4 regulates TNFalpha-induced IL-8 expression at a transcriptional level and this mechanism involves STAT6 and NF-kappaB transcription factors
16002690 IL-4 acts directly on mature osteoclasts and inhibits bone resorption by inhibiting NF-kappaB and calcium signaling.
16001979 These data suggest that during a respiratory virus infection activated CD8+ T cells from asthmatic subjects may produce excess type 2 cytokines and may contribute to asthma exacerbation by augmenting allergic inflammation.
15970635 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
15969687 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15969687 These data suggest that IL-4, IL-13 and IFN-gamma play an important roles in penicillins allergy.
15951665 Observational study of gene-disease association. (HuGE Navigator)
15951665 African-Americans with the IL4 GCC haplotype had greater risk of spontaneous preterm birth. White mothers with the IL4 CC haplotype had reduced risk of SGA. Carriers of the IL4(-589)T variant had increased risk of SGA for both groups.
15941525 Observational study of gene-disease association. (HuGE Navigator)
15932621 Observational study of gene-disease association. (HuGE Navigator)
15919378 IL-21 reduced IL-4-driven IgE synthesis by mitogen-stimulated human PBMC
15904474 Observational study of gene-environment interaction. (HuGE Navigator)
15900573 Observational study of gene-disease association. (HuGE Navigator)
15900573 The IL-4 gene -590 C/T polymorphism is associated with oral cancer.
15900570 Observational study of gene-disease association. (HuGE Navigator)
15885323 Interleukin-4 level has no correlation with the course of subacute sclerosing panencephalitis or its treatment, when the age, disease stage, and clinical condition of the patient are considered.
15883744 Retinoic acid inhibits CD40 plus IL-4 mediated IgE production through alterations of sCD23, sCD54 and IL-6 production
15869882 TH2-cytokines interleukin-4 and -13 have roles in regulating the gene expression pattern of human peripheral blood monocytes
15825027 Observational study of gene-disease association. (HuGE Navigator)
15825027 Reduced vaginal levels of anticandidal factors in IL-4*T homozygotes may increase susceptibility to recurrent vulvovaginal candidiasis.
15816837 transepidermal water loss was suppressed by TNF-alpha and IFN-gamma, and these effects were also inhibited by IL-4
15811521 Observational study of gene-disease association. (HuGE Navigator)
15778356 NK cells exposed to IL-4 do not exert DC selection, may impair efficient Th1 priming, and favor either tolerogenic or Th2-type responses
15755291 Observational study of gene-disease association. (HuGE Navigator)
15733644 Observational study of gene-disease association. (HuGE Navigator)
15723707 Observational study of gene-disease association. (HuGE Navigator)
15714203 IL-4 may act as an autocrine growth factor in pancreatic cancer cells.
15713213 Observational study of gene-disease association. (HuGE Navigator)
15695802 p100 has an important role in the assembly of STAT6 transcriptosome, and that p100 stimulates IL-4-dependent transcription by mediating interaction between STAT6 and CBP and recruiting chromatin modifying activities to STAT6-responsive promoters
15687724 Observational study of gene-disease association. (HuGE Navigator)
15679809 Observational study of gene-disease association. (HuGE Navigator)
15678501 IL-4 > PI3K/Akt > NF-(kappa)B signaling pathways, which activate androgen receptor signaling, play an important role during the development of androgen independent prostate cancer cells.
15676220 IL-4-producing cells inhibit the development of acute graft vs host disesase.
15661875 Although IL-4 has been reported to influence natural killer (NK) cell differentiation, mice deficient in IL-4 have normal NK cell numbers, phenotype, and effector functions.
15660293 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
15660235 Observational study of gene-disease association. (HuGE Navigator)
15644127 Observational study of gene-disease association. (HuGE Navigator)
15627726 Observational study of gene-disease association. (HuGE Navigator)
15627726 No significant association of the genotype or allelic frequency of IL-4 polymorphism with duration of intermittent mandatory ventilation.
15596681 Observational study of gene-disease association. (HuGE Navigator)
15592292 Observational study of gene-disease association. (HuGE Navigator)
15591113 distinct activity of the IL-4 signaling pathway in diffuse large B-cell lymphoma subtypes
15570643 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
15570643 IL-4 gene polymorphism is dependent on HLA-DRB1 genotype in patients with giant cell arteritis.
15563083 GATA-3 contributed to the production of IL-4, IL-5 in patients with allergic rhinitis.
15528258 IL-4 and IL-13 mediate the hypercontractility of intestinal muscle via a STAT6 pathway at the level of the smooth muscle cell. The STAT6 pathway may contribute to the hypercontractility of intestinal muscle in Crohn's disease.
15527169 In monocytes IL-4 has a dual function: to inhibit pro-inflammatory cytokine production and to suppress spontaneous apoptosis.
15501397 IL-4-producing cells are decreased in Behcet's disease
15474066 IL-4 and IL-13 secreted from embryo during implantation may up-regulate TARC by endometrial epithelial cells.
15373917 Observational study of gene-disease association. (HuGE Navigator)
15367434 exposure of human mast cells to IL-4, IL-5, and IFN-gamma during growth and differentiation generally down-regulated mast cell number and function, whereas IL-4 increased mature mast cell division and degranulation.
15361128 Observational study of genotype prevalence. (HuGE Navigator)
15322832 at a lower maturation stage, IL-4 acts as a negative regulator of the mast cell lineage, but that this property disappears or is even reversed upon terminal differentiation of the cell.
15298559 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
15297269 FN-gamma regulates IL-4- and STAT6-dependent signaling and gene expression in airway epithelial cells by multiple mechanisms
15292002 Observational study of genotype prevalence. (HuGE Navigator)
15274656 Observational study of gene-disease association. (HuGE Navigator)
15274656 IL-4 VNTR allele is not a major genetic regulator in recurrent pregnancy loss
15241348 Observational study of gene-disease association. (HuGE Navigator)
15215692 HIV-1 gp120 induces release of IL-4 in CD4+ T cells
15213252 IL-4 alone, in the absence of detectable endogenous GM-CSF, transforms human peripheral blood monocytes to a CD1a(dim) dendritic cell (DC) subset that could be matured to CD83(+) DCs
15210741 Interferon gamma showed a striking increase in the proportion of T cells that secreted IL-4 upon challenge.
15191519 Observational study of gene-disease association. (HuGE Navigator)
15187156 demonstrated induction of IgE synthesis by the interaction between adenosine-stimulated mast cells and B lymphocytes involves up-regulation of IL-4 and IL-13 mediated by A(2B) receptors
15178889 Observational study of gene-disease association. (HuGE Navigator)
15177147 Observational study of gene-disease association. (HuGE Navigator)
15170937 Observational study of gene-disease association. (HuGE Navigator)
15166131 Observational study of gene-disease association. (HuGE Navigator)
15166131 There were no differences in IL-4 -590C/T genotypes and allele frequencies between control women and all patients with endometriosis or between control women and each subgroup of patients with endometriosis.
15163899 Th2 cytokines IL-4 and IL-13 downregulate paxillin production by BAEC, thereby disrupting the cell-matrix interactions
15128803 In a transgenic mouse model, an IL-4 signal is required at the early stage of T-cell receptor-mediated T cell activation for lineage commitment to Th2 cells, along with structural changes in chromatin.
15123681 IRS-2-dependent IL-4 signaling in macrophages is impaired in models of type 2 diabetes mellitus through a mechanism that relies on insulin/glucose-dependent Ser/Thr-Pro motif serine phosphorylation mediated by the mTOR pathway
15122773 Observational study of gene-disease association. (HuGE Navigator)
15122773 the observed polymorphisms, resulting in low IL-10 and high IL-4 gene transcription, could favor a T helper (Th)-2 mediated antibody response to neoantigenic stimulation associated with hepatotoxicity susceptibility.
15100288 IL-4 strongly inhibits chemotherapy- and CD95-induced apoptosis through up-regulation of anti-apoptotic proteins Bcl-xL and cellular FLIP, suggesting that IL-4 production may contribute to apoptosis resistance of human solid tumors during Th2 responses.
15087090 Observational study of gene-disease association. (HuGE Navigator)
15086621 Observational study of gene-disease association. (HuGE Navigator)
15084933 Patients homozygous for GG at single nucleotide polymorphism -1082IL10 (high IL-10 producers) and HLA class I mismatched (but matched for class II) are protected from chronic rejection.
15063762 Observational study of gene-disease association. (HuGE Navigator)
15057902 Observational study of gene-disease association. (HuGE Navigator)
15051937 Activation of T cells and IL-4 production may be involved not only in the basic pathogenesis of childhood asthma but also in its acute exacerbation.
15042002 Observational study of gene-disease association. (HuGE Navigator)
15042002 Maternal and fetal carriage of the interleukin-4 T allele is associated with an increased risk of spontaneous preterm birth in multifetal gestations.
15041089 Alexithymia and difficulty in identifying feelings could be associated with increased levels of interleukin-4
15021309 Observational study of gene-disease association. (HuGE Navigator)
15014952 IL-4 mRNA expression was identified in only two of the eight very mild lesions, one of the ten subacute lesions, and none of the ten lichenified lesions in atopic dermatitis
15013759 IL-4 induced expression of fractalkine in fibroblasts, and subsequent monocyte chemotactic activity in the culture supernatant
15007352 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
15007352 variants in the IL4, IL13, and IL4RA genes play an important role in controlling specific IgE response in atopy
15004182 IL-4 induces the specific goblet cell product trefoil factor-3 (TTF3) expression via a direct effect on intestinal epithelial cells, through a STAT6- and de novo protein synthesis-dependent pathway.
15001290 Observational study of gene-disease association. (HuGE Navigator)
15001290 polymorphisms were not related to periodontal disease susceptibility in African-American Brazilian population
14986816 Observational study of gene-disease association. (HuGE Navigator)
14983029 Th1/Th2 differentiation and in a transgenic mouse line containing the human IL-4/IL-13 genes for intergenic transcripts
14767810 Observational study of gene-disease association. (HuGE Navigator)
14767810 IL-4 -589-C/T polymorphism is not an important determinant of HIV-1 disease progression in children.
14764715 When parasite antigen-specific IgE is present in a filaria-infected individual, basophils function to amplify the ongoing Th2 immune cell response by releasing IL-4 in greater amounts and more frequently than CD4+ T cells in response to filarial antigen.
14746805 Results indicate that interleukin-4, together with recombinant human stem cell factor, can induce T cell maturation from cord blood progenitor cells, and that IL-4 increased the expression of FcepsilonRI on fetal liver mast cells.
14729510 IL-4 could account for proinflammatory AM phenotype changes and B7 surface-marker shifts, as seen in subjects with systemic sclerosis
14725568 In maternal peripheral blood, the expression of IL-4 mRNA was up-regulated from the second gestational month (GM) to delivery
14697936 Significantly higher levels of il-18 were noted during the acute phase of infection among children with an increased incidence of respiratory infections.
14697238 IL-4 signaling is regulated by TGF-beta through targeting NF-kappaB signaling
14693849 Observational study of gene-disease association. (HuGE Navigator)
14692664 Results describe the effect of CD80 and CD86 inactivation on interleukin-4 and interferon-gamma production in nonatopic asthmatics and healthy subjects.
14688371 MC(T) type of mast cell (MC) from lung is sensitive to IL-4-induced apoptosis, whereas MC(TC) cells from both skin and lung are resistant; most in vitro derived mast cells from cord blood and fetal liver progenitors also are IL-4-sensitive.
14681304 Observational study of gene-disease association. (HuGE Navigator)
14681304 Interleukin 4 gene polymorphisms is associated with incident stroke
14675394 Observational study of gene-disease association. (HuGE Navigator)
14654080 there is increased production of IL4 by PHA-activated PB lymphocytes in Hodgkin lymphoma. The CD3(+)CD8(+) T-cell population appears to be responsible for this increased synthesis.
14652008 These results indicate that TNF-alpha and IL-4 synergistically up-regulate the expression of IL-13Ralpha2 decoy receptor on human fibroblasts
14634100 IL-4 up-regulates SOCS-1 expression in A549 human lung adenocarcinoma cells by stimulating interaction of STAT6 with three interferon-gamma-activated sequence (GAS) motifs in the SOCS-1 promoter.
14634065 skin mast cells precultured in the presence of IL-4 [alone or plus stem cell factor (SCF)] before anti-IgE stimulation, acquired the ability to produce IL-5, and IL-1beta was concomitantly suppressed
14610476 Observational study of gene-disease association. (HuGE Navigator)
14610476 Possible involvement of single nucleotide polymorphisms in IL4 gene in development of asthma and regulation of total serum IgE.
14583474 Autocrine production of IL-4 and IL-10 promotes thyroid tumor cell progression and resistance to chemotherapy through the up-regulation of antiapoptotic proteins.
14568946 IL-4 binds with high affinity to its receptor on transiently transfected hepatocellular carcinoma (Hep3B) cells, leading to a suppression of hepatitis B virus gene expression and replication.
14561191 interleukin-4 has emerged as promising means of improving allergic states, and several antagonists have been developed, among which soluble IL-4 receptor is now in human trials--REVIEW
14551608 Observational study of gene-disease association. (HuGE Navigator)
14530362 Treatment of airway epithelial cells with IL-4 in combination with TNF-alpha increases the stability of eotaxin mRNA.
14523823 Observational study of gene-disease association. (HuGE Navigator)
14522096 Observational study of genotype prevalence. (HuGE Navigator)
14503851 results show that IL-4 inhibits endothelial cell growth by altering the expression of cell cycle regulatory molecules p53, p21(Waf1), cyclin D1 and cyclin E
14499500 Number of CD8+/IL-4 cells significantly higher in young than in elderly untrained.
12973929 Observational study of gene-disease association. (HuGE Navigator)
12944981 Observational study of gene-disease association. (HuGE Navigator)
12944981 Single Nucleotide Polymorphism in interleukin 4 gene is associated with AIDS progression
12940513 Observational study of gene-disease association. (HuGE Navigator)
12940513 IL-4 gene polymorphism are associated with allergic asthma in a Chinese population.
12911786 Observational study of gene-disease association. (HuGE Navigator)
12902508 Blocking of IL-4-induced activation of epithelial Stat6 by Helicobacter pylori in vitro may represent an evolutionarily conserved strategy to disrupt a Th2 response and evade the host immune system, allowing for successful chronic infection.
12900808 Observational study of gene-disease association. (HuGE Navigator)
12897746 Observational study of gene-disease association. (HuGE Navigator)
12897746 No genotypic effects on total serum IgE levels.
12884288 expression of alleles of the genes encoding IL-2, IL-3, IL-4, and IL-13 in CD4(+) T cell clones
12877559 Observational study of gene-disease association. (HuGE Navigator)
12877559 The IL-4 gene locus (-590 C-->T polymorphism and 70 bp repeat polymorphism) contributes little to the interindividual susceptibility for adult periodontitis in a Korean population.
12851716 In all three groups of patients significant correlation was seen between abundance of IL-2 vs. IL-4, IL-5, IL-10, or TNF-alpha, between IL-4 vs. IL-10, and between TNF-alpha vs. INF-gamma
12753568 Observational study of gene-disease association. (HuGE Navigator)
12748907 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
12748907 IL4 is associated with diabetes mellitus, type 1 in Filipinos.
12738651 Constitutive expression of BPI, which increases upon interleukin 4 stimulation, by human dermal fibroblast was demonstrated, suggesting an important role of BPI in gram-negative bacterial clearance and a dampened response to endotoxin in the skin
12715242 Observational study of gene-disease association. (HuGE Navigator)
12700447 Observational study of gene-disease association. (HuGE Navigator)
12694433 Observational study of gene-disease association. (HuGE Navigator)
12689929 IL-4 regulates osteoclast development by regulating gene expression, including RANK
12687247 Observational study of gene-disease association. (HuGE Navigator)
12687213 Observational study of gene-disease association. (HuGE Navigator)
12667657 Observational study of gene-disease association. (HuGE Navigator)
12663328 the anti-inflammatory cytokine IL-4 modulates the life span of monocytes by an extracellular signal-regulated kinase-dependent pathway
12660931 Observational study of gene-disease association. (HuGE Navigator)
12660931 Genetic variants of IL4 could contribute to the development of chronic disseminated candidiasis in adult patients with acute leukemia
12626590 Inhibition of a rapid anaphylatoxin-induced mobilization of monocytes and dendritic cells to inflamed tissues represents an important anti-inflammatory activity of the Th2 cytokine IL-4.
12613995 In conjunctiva of keratoconjunctivitis sicca patients.
12600829 All nine patients expressed all of the TLRs studied, whereas only five out of the nine patients had any granulomas positive for IL-4.The associations between TLRs 1, 5, and 9 were different in IL-4-negative compared with IL-4-positive patients.
12595908 Observational study of gene-disease association. (HuGE Navigator)
12587822 Observational study of gene-disease association. (HuGE Navigator)
12587822 association between RPI/RPI and T/T homozygous carriage and patients with discoid rash in systemic lupus erythematosus
12578333 Observational study of gene-disease association. (HuGE Navigator)
12574355 IL-4 alone is sufficient to drive activation-induced expression of cytidine deaminase via JAK/STAT pathways in primary B cells.
12552499 Observational study of gene-disease association. (HuGE Navigator)
12552499 IL-4 gene polymorphisms are associated with disease susceptibility and disease progression in IgA nephropathy in Japanese patients.
12542496 HIV-1 gp120 induces release of IL-4 in CD4+ T cells
12525574 Protease allergen Der p1 and the secreted proteases of the hookworm Necator americanus are able to directly induce type 2 cytokines IL-4, IL-5, and IL-13 by basophils, that could promote IgE synthesis, eosinophil recruitment, and Th2 cells.
12517954 IL-4-stimulated A549 lung adenocarcinoma cells are committed to apoptosis via the caspase-3 pathway involving the binding of 15(S)-HETE to PPAR gamma transcription factor, the down-regulation of Bcl-XL, and the resultant overexpression of Bax.
12515722 A non-secreted Il-4 variant whose expression is tightly associated with deprivation apoptosis was detectd in T-cells. This variant is the major form detected in HIV-infected patients.
12513914 Lack of antitumor activity and intolerance of this drug in patients with advanced HIV disease and Kaposi's sarcoma.
12509382 induces human germinal center-associated lymphoma gene
12508786 Observational study of gene-disease association. (HuGE Navigator)
12508786 Polymorphisms in the IL-4 gene did not reveal any association with increased risk of developing rheumatoid arthritis in Taiwan Chinese.
12508140 Observational study of gene-disease association. (HuGE Navigator)
12504082 Human IL-21 and IL-4 bind to partially overlapping epitopes of common gamma-chain.
12479817 IRF-1 and IRF-2 induced by IFN-gamma bind to three distinct IL-4 promoter sites and function as transcriptional repressors
12470598 IL4 regulates differentiation and maturation of dendritic cells in cooperation with DC21 and IL-12
12442007 Observational study of gene-disease association. (HuGE Navigator)
12441140 lack of role in modulating thymus and activation-regulated chemokine/CCL17 and interferon-induced protein of 10kDA/CXCL10 release by tumor necrosis factor-alpha and interferon-gamma in HaCaT cell line
12435565 Observational study of gene-disease association. (HuGE Navigator)
12435565 IL-4 intron 3 polymorphism is not a useful marker for prediction of the susceptibility of febrile seizure and epilepsy of children.
12426308 mediates STAT6 signaling; regulated by protein phosphatase 2a
12420205 Observational study of gene-disease association. (HuGE Navigator)
12402189 Observational study of gene-disease association. (HuGE Navigator)
12402189 a common haplotype of the gene is associated with severe respiratory syncytial virus disease in Korean children
12368275 IL-4 induction requires c-jun N-terminal kinase
12366695 expression of mRNA for IL-4, IL-5, TGF-beta1, IFN-gamma in patients with cicatricial pemphigoid
12363051 Observational study of gene-disease association. (HuGE Navigator)
12358844 Observational study of gene-disease association. (HuGE Navigator)
12220533 results suggest that in DG75 cells, TRAF3-induced MEK1 activation may be involved in CD40-mediated upregulation of IL-4-driven germline C epsilon transcription
12207324 Vitamin E inhibits IL-4 gene expression in peripheral blood T cells by blocking binding of transcription factors to two important IL-4 promoter binding sites for NF-kappaB and AP-1 and interfering with promoter activity upon T cell activation.
12165514 DNA methylation around the IL-4 and IL-13 genes before and after T cell differentiation
12162874 During the latent phase of HSV-1 infection, IL-4 expression was significantly elevated in BALB/C mouse brains when compared with the uninfected controls.
12161424 These results show that p38 MAPK provides a costimulatory signal for IL-4-induced gene responses by directly stimulating the transcriptional activation of STAT6.
12144536 B-CLL patients with progressive disease had a significantly increased number of T cells spontaneously producing IL-2, IL-4 and GM-CSF, suggesting a role for T cells in the pathogenesis of B-CLL.
12133437 Observational study of gene-disease association. (HuGE Navigator)
12133437 There is correlation between the Chinese ulcerative colitis patients and the gene polymorphisms of intron 3 of IL-4.
12124654 Observational study of gene-disease association. (HuGE Navigator)
12121273 Observational study of genotype prevalence. (HuGE Navigator)
12115161 Observational study of gene-disease association. (HuGE Navigator)
12115161 Association of interleukin-4 and interleukin-1B gene variants with Larsen score progression in rheumatoid arthritis.
12107748 data are consistent with a reduced capacity to make IL-4 promoted antibody responses to exogenous antigen in early pre-diabetes
12105273 IL-4 was found to down-regulate IFN-gamma and tumor necrosis factor alpha, and HIV-1 p17 restored the ability of cells to produce both cytokines
12105273 HIV-1 gp120 induces release of IL-4 in CD4+ T cells
12102661 results indicate opposite effects of IFN-gamma and IL-4 on VEGF expression from normal and activated HF and HK
12089714 Observational study of gene-disease association. (HuGE Navigator)
12082592 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
12072494 increased HIV replication in the thymus by inducing differentiation and expansion of mature CD27(+) thymocytes expressing CXCR4 or CCR5
12063527 Cysteinyl leukotrienes acting on human eosinophils can act as autocrine or paracrine mediators to stimulate the rapid, nonexocytotic release of preformed IL-4.
12039414 Acute cardiac transplant rejection is associated with low frequencies of interleukin-4 producing helper T-lymphocytes rather than with interleukin-4 promoter or splice variants.
12030894 Observational study of gene-disease association. (HuGE Navigator)
12020266 Observational study of gene-disease association. (HuGE Navigator)
11994288 CD45 controls interleukin-4-mediated IgE class switch recombination in human B cells
11980568 Observational study of gene-disease association. (HuGE Navigator)
11968047 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
11968047 Polymorphisms for interleukin-4 (IL-4) -590 promoter, IL-4 intron3, and tumor necrosis factor alpha -308 promoter: non-association with endometriosis
11967989 IL-4 interfered with the TGF-beta-induced transcriptional activation of the CTGF gene.
11960309 Uncategorized study of gene-disease association. (HuGE Navigator)
11953141 Observational study of genotype prevalence and gene-disease association. (HuGE Navigator)
11950517 Observational study of gene-disease association. (HuGE Navigator)
11930331 Observational study of gene-disease association. (HuGE Navigator)
11922633 Observational study of gene-disease association. (HuGE Navigator)
11920312 regulates CCR5 amd CD4 expression and HIV-1 replication in human macrophages and microglia
11907068 The germinal center (GC) B cells in tonsils and colonic mucosa are a predominant source of IL-4 and demonstrate the reliance of IL-4-dependent Th2 differentiation in vivo on strong B cell participation and the development of GCs.
11897522 Observational study of gene-disease association. (HuGE Navigator)
11886168 Interleukin (IL)-4 inhibits phorbol-ester induced HIV-1 expression in chronically infected U1 cells independently from the autocrine effect of endogenous tumour
11881490 Observational study of gene-disease association. (HuGE Navigator)
11877044 IL-4 enhance cytotoxic T-Lymphocytes activity by inducing cell surface molecules expression and IL-2 secretion.
11872954 Oligonucleotide fishing for STAT6: cross-talk between IL-4 and chemokines.
11842291 The acetylation state of histones associated with the IL-4 promoter is a key regulator of IL4 gene expression in T cells.
11841848 role in regulation of Toll-like receptor surface expression in human peripheral blood monocytes and B cells
11811777 Characterization of IL-4 receptor components expressed on monocytes and monocyte-derived macrophages: variation associated with differential signaling by IL-4
11786020 high-affinity interaction of human IL-4 and the receptor alpha chain is constituted by two independent binding clusters
11777980 Incubation of cultured bronchial epithelium with IL-4 causes marked inhibition of the amiloride-sensitive Na+ channel, as well as up-regulation of the cyclic AMP-dependent current demonstrated by an increase in chloride secretion and CFTR mRNA level.
11728464 expression in T cells up-regulated by CD30L
11704810 Observational study of genotype prevalence. (HuGE Navigator)
11678851 Observational study of gene-disease association. (HuGE Navigator)
11528525 Observational study of gene-disease association. (HuGE Navigator)
11502824 Observational study of gene-disease association. (HuGE Navigator)
11496248 Observational study of gene-disease association. (HuGE Navigator)
11466338 Increased IL-4 expression in Mycobacterium tuberculosis-activated lymphocytes promotes CD30 expression, which sensitizes the lymphocytes to TNF-alpha-mediated apoptosis via TRAF2 depletion.
11396683 HIV-1 gp120 induces release of IL-4 in CD4+ T cells
11350513 Observational study of gene-disease association. (HuGE Navigator)
11316069 Observational study of gene-disease association. (HuGE Navigator)
11316066 Observational study of gene-disease association. (HuGE Navigator)
11315919 Observational study of gene-disease association. (HuGE Navigator)
11298547 Observational study of gene-disease association. (HuGE Navigator)
11294568 Observational study of gene-disease association. (HuGE Navigator)
11258696 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
11258628 Observational study of genotype prevalence. (HuGE Navigator)
11233912 Observational study of gene-disease association. (HuGE Navigator)
11167377 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
11149986 HIV-1 gp120 induces release of IL-4 in CD4+ T cells
11122213 Observational study of gene-disease association. (HuGE Navigator)
11035134 Observational study of gene-disease association. (HuGE Navigator)
11023480 Observational study of gene-disease association. (HuGE Navigator)
10853974 HIV-1 gp120 induces release of IL-4 in CD4+ T cells
10710213 HIV-1 gp120 induces release of IL-4 in CD4+ T cells
10623799 HIV-1 gp120 induces release of IL-4 in CD4+ T cells
9334723 HIV-1 gp120 induces release of IL-4 in CD4+ T cells
8764000 HIV-1 gp120 induces release of IL-4 in CD4+ T cells
7695626 HIV-1 gp120 induces release of IL-4 in CD4+ T cells
7589092 HIV-1 gp120 induces release of IL-4 in CD4+ T cells
7523014 HIV-1 gp120 induces release of IL-4 in CD4+ T cells
1346976 HIV-1 gp120 induces release of IL-4 in CD4+ T cells

AA Sequence

MGLTSQLLPPLFFLLACAGNFVHGHKCDITLQEIIKTLNSLTEQKTLCTELTVTDIFAASKNTTEKETFC      1 - 70
RAATVLRQFYSHHEKDTRCLGATAQQFHRHKQLIRFLKRLDRNLWGLAGLNSCPVKEANQSTLENFLERL     71 - 140
KTIMREKYSKCSS                                                             141 - 153
//

Text Mined References (992)

PMID Year Title
27080531 2016 Unexpected impairment of TNF-?-induced maturation of human dendritic cells in vitro by IL-4.
26927386 2016 [Alterations of IFN-? and IL-4 of peripheral blood T cells in patients with chronic HBV infection].
26879815 2016 Distribution of allelic and genotypic frequencies of IL1A, IL4, NFKB1 and PAR1 variants in Native American, African, European and Brazilian populations.
26861613 2016 Interleukin-1Ra rs2234663 and Interleukin-4 rs79071878 Polymorphisms in Familial Mediterranean Fever.
26831416 2015 A preliminary study on the association of single nucleotide polymorphisms of interleukin 4 (IL4), IL13, IL4 receptor alpha (IL4R?) & Toll-like receptor 4 (TLR4) genes with asthma in Indian adults.
26829670 2016 External signals shape the epigenome.
26758199 2016 IL-4 orchestrates STAT6-mediated DNA demethylation leading to dendritic cell differentiation.
26755820 2016 IL-4 Inhibits the Biogenesis of an Epigenetically Suppressive PIWI-Interacting RNA To Upregulate CD1a Molecules on Monocytes/Dendritic Cells.
26751822 2016 Differential Expression Profile of Immunological Cytokines in Local Ovary in Patients with Polycystic Ovarian Syndrome: analysis by Flow Cytometry.
26732352 2016 Production of interleukins 4 and 10 in children with hepatic involvement in the course of Toxocara spp. infection.
26562652 2015 Dynamic Redox Regulation of IL-4 Signaling.
26517657 2015 High interleukin-4 expression and interleukin-4 gene polymorphisms are associated with susceptibility to human paracoccidioidomycosis.
26515179 2015 Role of Interleukin-4, Interleukin-10, and Tumor Necrosis Factor-? Polymorphic Genes in the Pathogenesis of Occupational Allergic Dermatoses.
26507707 2015 Multicolor flow-cytometric analysis of milk allergen-specific T-helper type 2 cells revealed coexpression of interleukin-4 with Foxp3.
26504066 2015 Contribution of Interleukin-4 Genotypes to Lung Cancer Risk in Taiwan.
26440137 2016 Interleukin 4 inhibition as a potential therapeutic in pemphigus.
26436920 2015 miR-142-5p and miR-130a-3p are regulated by IL-4 and IL-13 and control profibrogenic macrophage program.
26405199 2015 A SnoRNA-derived piRNA interacts with human interleukin-4 pre-mRNA and induces its decay in nuclear exosomes.
26383107 2015 Significant Association of Interleukin4 Intron 3 VNTR Polymorphism with Susceptibility to Gastric Cancer in a South Indian Population from Telangana.
26334904 2015 Association Between IL-4 Polymorphisms and Risk of Liver Disease: An Updated Meta-Analysis.
26289664 2016 Interleukin-4 polymorphism is associated with severity of respiratory syncytial virus infection.
26288354 2015 TSLP Directly Interacts with Skin-Homing Th2 Cells Highly Expressing its Receptor to Enhance IL-4 Production in Atopic Dermatitis.
26281177 2015 [IMMUNOGENETICS AND PROGRESSION OF CHRONIC VIRAL HEPATITES].
26276392 2015 AMP-activated protein kinase suppresses arachidonate 15-lipoxygenase expression in interleukin 4-polarized human macrophages.
26265379 2015 Association Study of IL-4 -590 C/T and DDX39B -22 G/C Polymorphisms with the Risk of Late-Onset Alzheimer's Disease in Iranian Population.
26231284 2015 IL-33 and IL-4 impair barrier functions of human vascular endothelium via different mechanisms.
26138543 2015 Correlation of interleukin-4 levels with Plasmodium falciparum malaria parasitaemia in Sudanese children.
26111352 2015 Obesity, asthma prevalence and IL-4: Roles of inflammatory cytokines, adiponectin and neuropeptide Y.
26111149 2015 Genetic variants within immune-modulating genes influence the risk of developing rheumatoid arthritis and anti-TNF drug response: a two-stage case-control study.
26093164 2015 Receptor-selective IL-4 mutein modulates inflammatory vascular cell phenotypes and attenuates atherogenesis in apolipoprotein E-knockout mice.
26088754 2015 Mast cell production and response to IL-4 and IL-13.
26073683 2015 The differential expression of IL-4 and IL-13 and its impact on type-2 immunity.
26072972 2015 TL1A as a Potential Local Inducer of IL17A Expression in Colon Mucosa of Inflammatory Bowel Disease Patients.
26070934 2015 IL-4 and IL-13 signaling in allergic airway disease.
26046681 2015 Salivary Immunosuppressive Cytokines IL-10 and IL-13 Are Significantly Elevated in Oral Squamous Cell Carcinoma Patients.
26044597 2015 T helper 2 (Th2) cell differentiation, type 2 innate lymphoid cell (ILC2) development and regulation of interleukin-4 (IL-4) and IL-13 production.
25985710 Peripheral blood mononuclear cells from severe asthmatic children release lower amounts of IL-12 and IL-4 after LPS stimulation.
25973044 2015 Expression of IL-4 and IL-13 predicts recurrence and survival in localized clear-cell renal cell carcinoma.
25952120 2015 Histone H3k9 and H3k27 Acetylation Regulates IL-4/STAT6-Mediated Ig? Transcription in B Lymphocytes.
25935236 2015 Genotype combinations of two IL4 polymorphisms influencing IL-4 plasma levels are associated with different risks of severe malaria in the Malian population.
25922277 2015 Humoral immune responses against the malaria vaccine candidate antigen Plasmodium vivax AMA-1 and IL-4 gene polymorphisms in individuals living in an endemic area of the Brazilian Amazon.
25826984 2014 [The role of genetic polymorphisms of interleukins in chronic lymphocytic leukemia in patients of different ages].
25819429 2015 Spatial regulation of IL-4 signalling in vivo.
25814340 2015 History of interleukin-4.
25747600 2015 Associations of IL-2 and IL-4 Expression and Polymorphisms With the Risks of Mycoplasma pneumoniae Infection and Asthma in Children.
25733581 2015 CD10 delineates a subset of human IL-4 producing follicular helper T cells involved in the survival of follicular lymphoma B cells.
25682112 2015 IL-4 Induces Cholinergic Differentiation of Retinal Cells In Vitro.
25674935 2015 Expression of POSTN, IL-4, and IL-13 in Chronic Rhinosinusitis with Nasal Polyps.
25667413 2015 Filarial infection modulates the immune response to Mycobacterium tuberculosis through expansion of CD4+ IL-4 memory T cells.
25666199 2015 Correlation of an interleukin-4 gene polymorphism with susceptibility to severe enterovirus 71 infection in Chinese children.
25646481 2015 IL-4 abrogates T(H)17 cell-mediated inflammation by selective silencing of IL-23 in antigen-presenting cells.
25585038 2015 Preliminary study on pathogenesis of bronchial asthma in children.
25537796 2015 Interleukin-4 -589C/T Polymorphism is Associated with Increased Pediatric Asthma Risk: A Meta-Analysis.
25530681 2014 The effect of IL-4 gene polymorphisms on cytokine production in patients with chronic periodontitis and in healthy controls.
25454624 2014 Analysis of genetic variants in the IL4 promoter and VNTR loci in Indian patients with Visceral Leishmaniasis.
25450271 2014 Association between interleukin-4 polymorphisms and environment and nonsmall cell lung cancer in Chinese population.
25418473 2015 Response gene to complement 32 (RGC-32) expression on M2-polarized and tumor-associated macrophages is M-CSF-dependent and enhanced by tumor-derived IL-4.
25413124 2015 Increased miR-155 expression in peripheral blood mononuclear cells of primary immune thrombocytopenia patients was correlated with serum cytokine profiles.
25343318 2014 Association of interleukin 4 gene polymorphisms with dental implant loss.
25330798 2015 Association of IL4 single-nucleotide polymorphisms with febrile seizures.
25320043 2014 Interleukin-4 single nucleotide polymorphisms in juvenile systemic lupus erythematosus.
25310970 2014 uPAR induces expression of transforming growth factor ? and interleukin-4 in cancer cells to promote tumor-permissive conditioning of macrophages.
25308608 2015 Interleukin-4 and interleukin-10 polymorphisms and antituberculosis drug-induced hepatotoxicity in Chinese population.
25303100 2014 Plasma cytokine profile in tropical endomyocardial fibrosis: predominance of TNF-a, IL-4 and IL-10.
25295591 2014 Role of IL-4 gene polymorphisms in HBV-related hepatocellular carcinoma in a Chinese population.
25286078 2015 Genetic variants of interleukin-4 gene in autoimmune thyroid diseases: an updated meta-analysis.
25239315 2014 An interleukin-4 polymorphism is associated with susceptibility to Clostridium difficile infection in patients with inflammatory bowel disease: results of a retrospective cohort study.
25189918 The evaluation of angiotensin-converting enzyme (ACE) gene I/D and IL-4 gene intron 3 VNTR polymorphisms in coronary artery disease.
25170298 2014 Impact of single nucleotide polymorphism in IL-4, IL-4R genes and systemic concentration of IL-4 on the incidence of glioma in Iraqi patients.
25060515 2015 The effect of IL-4 and MTHFR gene variants in ankylosing spondylitis.
25051072 2014 Expression of IL4 (VNTR intron 3) and IL10 (-627) genes polymorphisms in childhood immune thrombocytopenic purpura.
25029213 2014 Association between interleukin-4 gene -590 c/t, -33 c/t, and 70-base-pair polymorphisms and periodontitis susceptibility: a meta-analysis.
25017270 2014 An association study of interleukin-4 gene and preeclampsia in Taiwan.
24991184 2014 Interleukin-4 and melatonin ameliorate high glucose and interleukin-1? stimulated inflammatory reaction in human retinal endothelial cells and retinal pigment epithelial cells.
24960198 2014 IL-4 receptor ? in non-lipid rafts is the target molecule of strictinin in inhibiting STAT6 activation.
24949794 2014 Assessment of genetic associations between common single nucleotide polymorphisms in RIG-I-like receptor and IL-4 signaling genes and severe respiratory syncytial virus infection in children: a candidate gene case-control study.
24943510 2014 Interleukin-4 up-regulation of epidermal interleukin-19 expression in keratinocytes involves the binding of signal transducer and activator of transcription 6 (Stat6) to the imperfect Stat6 sites.
24939291 2014 Association between promoter polymorphisms of interleukin-4 gene and allergic rhinitis risk: a meta-analysis.
24933945 2013 [The character of the morphological changes of the mucous membrane of the large intestine and the genetic polymorphism of IL-1RA, IL-1B, IL-4 TNFA in patient with irritable bowel syndrome].
24877103 2014 Possible association of IL-4 VNTR polymorphism with susceptibility to preeclampsia.
24872120 2015 Cytokine gene associations with self-report ratings of morning and evening fatigue in oncology patients and their family caregivers.
24850227 2015 The IL-1RN and IL-4 gene polymorphisms are potential genetic markers of susceptibility to bladder cancer: a case-control study.
24834774 2014 The -33C/T polymorphism in the interleukin 4 gene is associated with asthma risk: a meta-analysis.
24828787 2015 Loss of cooperativity of secreted CD40L and increased dose-response to IL4 on CLL cell viability correlates with enhanced activation of NF-kB and STAT6.
24819208 2014 Gene polymorphisms and febrile neutropenia in acute leukemia--no association with IL-4, CCR-5, IL-1RA, but the MBL-2, ACE, and TLR-4 are associated with the disease in Turkish patients: a preliminary study.
24815430 2014 Interleukin-4 and -8 gene polymorphisms and risk of gastric cancer in a population in Southwestern China.
24808368 2014 Intravenous immunoglobulin treatment in humans suppresses dendritic cell function via stimulation of IL-4 and IL-13 production.
24778440 2014 CD4+ T cells from human neonates and infants are poised spontaneously to run a nonclassical IL-4 program.
24742632 2014 Association between genes encoding components of the IL-4/IL-4 receptor pathway and dermatitis in children.
24738292 [Features of dynamics of sera cytokines in patients with erythema multiforme during immunotherapy].
24732061 Expression and correlation analysis of IL-4, IFN-? and Fc?RI in tonsillar mononuclear cells in patients with IgA nephropathy.
24707478 2014 The effects of gene polymorphisms in interleukin-4 and interleukin-6 on the susceptibility of rheumatoid arthritis in a Chinese population.
24680475 2014 The role of IL-4 gene 70 bp VNTR and ACE gene I/D variants in Familial Mediterranean fever.
24679691 2014 Altered atherosclerotic-related gene expression signature in circulating mononuclear leukocytes from hypercholesterolemic patients with low HDL cholesterol levels.
24668571 2014 Association of IL1? and IL4 gene polymorphisms with nasal polyps in a Polish population.
24666229 2014 Serum cytokine and chemokine profiles in patients with myasthenia gravis.
24634237 2014 Association of IL-4 promoter polymorphisms with asthma: a meta-analysis.
24628947 2015 Relationship between the IL-4 gene promoter -590C/T (rs2243250) polymorphism and susceptibility to autoimmune diseases: a meta-analysis.
24521636 2013 Interleukin-4 in rheumatoid arthritis patients with interstitial lung disease: a pilot study.
24518693 2014 rs2243268 and rs2243274 of Interleukin-4 (IL-4) gene are associated with reduced risk for extrapulmonary and severe tuberculosis in Chinese Han children.
24510574 2014 [Association study of bronchial asthma with polymorphisms of IL-4 and IL-4R receptor genes].
24510479 2014 Interleukin-4 and interleukin-13 compromise the sinonasal epithelial barrier and perturb intercellular junction protein expression.
24491812 2014 High risk association of IL-4 VNTR polymorphism with asthma in a North Indian population.
24464250 2014 Lack of association between IL-4 -588C>T polymorphism and NHL susceptibility.
24463336 2014 Association of interleukin-4 genetic polymorphisms with sporadic Alzheimer's disease in Chinese Han population.
24463275 2014 Cytokine profiles in polycythemia vera and essential thrombocythemia patients: clinical implications.
24460857 2014 Alterations in immune cell subsets and their cytokine secretion profile in childhood idiopathic thrombocytopenic purpura (ITP).
24447084 2014 Quantification of circulating house dust mite-specific IL-4- and IL-13-secreting T cells correlates with rhinitis severity in asthmatic children and varies with the seasons.
24447082 2014 Differential expression of 11?-hydroxysteroid dehydrogenase type 1 and 2 in mild and moderate/severe persistent allergic nasal mucosa and regulation of their expression by Th2 cytokines: asthma and rhinitis.
24406619 2014 Significant association of interleukin-4 gene intron 3 VNTR polymorphism with susceptibility to knee osteoarthritis.
24318972 2014 Lack of association between interleukin-4 -524C>T polymorphism and colorectal cancer susceptibility.
24313289 2014 Association of cytokine gene polymorphisms in patients with tuberculosis and their household contacts.
24280725 2014 In vitro assessment of IL-4- or IL-13-mediated changes in the structural components of keratinocytes in mice and humans.
24272083 2014 Association between interleukin-4 -590C > T polymorphism and non-Hodgkin's lymphoma risk.
24218339 2014 Association between IL-4 -589C>T polymorphism and colorectal cancer risk.
24169152 2014 A high IL-4 production diplotype is associated with an increased risk but better prognosis of oral and pharyngeal carcinomas.
24167373 2013 Association of IL-4-590 C>T and IL-13-1112 C>T gene polymorphisms with the susceptibility to type 2 diabetes mellitus.
24164868 2014 Opposing effects of pro- and anti-inflammatory cytokine gene polymorphisms on the risk for breast cancer in western Indian women: a pilot study.
24161121 2014 Effect of IL-12B, IL-2, TGF-?1, and IL-4 polymorphism and expression on hepatitis B progression.
24119107 2014 Cytokine profiling in patients with VCP-associated disease.
24107646 2013 Activation of the interleukin-4/signal transducer and activator of transcription 6 signaling pathway and homeodomain-interacting protein kinase 2 production by tonsillar mononuclear cells in IgA nephropathy.
24089996 2013 The 30-kDa and 38-kDa antigens from Mycobacterium tuberculosis induce partial maturation of human dendritic cells shifting CD4(+) T cell responses towards IL-4 production.
24078930 2013 Increased production of interleukin-4, interleukin-10, and granulocyte-macrophage colony-stimulating factor by type 2 diabetes' mononuclear cells infected with dengue virus, but not increased intracellular viral multiplication.
24075353 Gene polymorphisms of Interleukin-4 in allergic rhinitis and its association with clinical phenotypes.
24072495 2014 Association between IL-4 -590C>T polymorphism and gastric cancer risk.
24007654 2013 Interleukin 4 haplotypes of susceptibility to chronic periodontitis are associated with IL-4 protein levels but not with clinical outcomes of periodontal therapy.
23984295 2013 Immunological parameters and gene polymorphisms (C-590T IL4, C-597A IL10) in severe bronchial asthma in children from the Krasnoyarsk region, West Siberia.
23983153 2013 Association of genetic variants in the IL4 and IL4R genes with the severity of joint damage in rheumatoid arthritis: a study in seven cohorts.
23964553 2013 Relationship between polymorphisms in IL4 and asthma in Japanese women: the Kyushu Okinawa Maternal and Child Health Study.
23958647 2013 IL-4 confers resistance to IL-27-mediated suppression on CD4+ T cells by impairing signal transducer and activator of transcription 1 signaling.
23936398 2013 Discordance in CD4+T-cell levels and viral loads with co-occurrence of elevated peripheral TNF-? and IL-4 in newly diagnosed HIV-TB co-infected cases.
23935100 2013 Interleukin-4 induces senescence in human renal carcinoma cell lines through STAT6 and p38 MAPK.
23924473 2013 Association between the polymorphisms of interleukin-4, the interleukin-4 receptor gene and asthma.
23923066 2013 IL4 and IL-17A provide a Th2/Th17-polarized inflammatory milieu in favor of TGF-?1 to induce bronchial epithelial-mesenchymal transition (EMT).
23913957 2013 Mechanistic target of rapamycin activation triggers IL-4 production and necrotic death of double-negative T cells in patients with systemic lupus erythematosus.
23883285 2013 Interleukin-4, interleukin-4 receptor, and interleukin-18 polymorphisms and rheumatoid arthritis: a meta-analysis.
23844087 2013 TLR3-induced placental miR-210 down-regulates the STAT6/interleukin-4 pathway.
23831512 2013 The association between Interleukin (IL)-4 gene intron 3 VNTR polymorphism and alopecia areata (AA) in Turkish population.
23797532 2013 Longitudinal trajectory of vitamin D status from birth to early childhood in the development of food sensitization.
23774696 Interleukin-4 (-590 C>T) and interleukin-4 receptor (Q551R A>G) gene polymorphisms in Saudi patients with vitiligo.
23771787 2013 High association of IL-4 gene intron 3 VNTR polymorphism with diabetic peripheral neuropathy.
23768103 2013 IL-4 -590C/T polymorphism and susceptibility to liver disease: a meta-analysis and meta-regression.
23766027 2013 Association of variable number of tandem repeat polymorphism in the IL-4 gene with ischemic stroke in the Chinese Uyghur population.
23756192 2013 Association between interleukin 4 gene intron 3 VNTR polymorphism and recurrent aphthous stomatitis in a cohort of Turkish patients.
23756167 2013 Association of interleukin (IL)-4 gene intron 3 VNTR polymorphism with multiple sclerosis in Turkish population.
23748736 2013 Periodontopathogens levels and clinical response to periodontal therapy in individuals with the interleukin-4 haplotype associated with susceptibility to chronic periodontitis.
23742784 2013 Coronary artery ectasia and inflammatory cytokines: link with a predominant Th-2 immune response?
23694808 2013 Human IL-31 is induced by IL-4 and promotes TH2-driven inflammation.
23685257 2013 IL-4 and MTHFR gene polymorphism in rheumatoid arthritis and their effects.
23677722 2014 Association of interleukin-4 gene polymorphisms with ischemic heart failure.
23668806 2013 Association of IL-4 and IL-10 maternal haplotypes with immune responses to P. falciparum in mothers and newborns.
23654077 2013 IL-4 gene polymorphisms and their association with atopic asthma and allergic rhinitis in Pakistani patients.
23651591 2013 Association of polymorphisms in the interleukin-4 gene with response to hepatitis B vaccine and susceptibility to hepatitis B virus infection: a meta-analysis.
23644020 2013 Association between fibromyalgia syndrome and polymorphism of the IL-4 gene in a Turkish population.
23597562 2013 Inhibition of tumor angiogenesis and growth by a small-molecule multi-FGF receptor blocker with allosteric properties.
23591975 2013 Anti-inflammatory/regulatory cytokine microenvironment mediated by IL-4 and IL-10 coordinates the immune response in hemophilia A patients infected chronically with hepatitis C virus.
23576103 2013 The -590C/T polymorphism in the IL-4 gene and the risk of cancer: a meta-analysis.
23572437 2013 Three common polymorphisms in the IL-4 gene and cancer risk: a meta-analysis involving 5,392 cases and 6,930 controls.
23559861 2013 Association of IL-4 gene VNTR variant with deep venous thrombosis in Behçet's disease and its effect on ocular involvement.
23527710 TNF-alpha, IL-4R-alpha and IL-4 polymorphisms in mild to severe asthma from Italian Caucasians.
23527200 2013 Increased production of IL-4 and IL-12p40 from bronchoalveolar lavage cells are biomarkers of Mycobacterium tuberculosis in the sputum.
23511027 2013 A polymorphism in IL4 may associate with sensory neuropathy in African HIV patients.
23454622 2013 The interleukin-4 -589C/T polymorphism and the risk of asthma: a meta-analysis including 7,345 cases and 7,819 controls.
23398789 2013 Association between the interleukin-4 gene C-589T and C+33T polymorphisms and asthma risk: a meta-analysis.
23394902 2013 Influence of interleukin-4 gene polymorphisms and interleukin-4 serum level on susceptibility and severity of rheumatoid arthritis in Egyptian population.
23376457 2013 Cytokine gene polymorphisms in Tunisian endemic pemphigus foliaceus: a possible role of il-4 variants.
23351078 2013 IL-4 and IL-13 inhibit IL-1? and TNF-? induced kinin B1 and B2 receptors through a STAT6-dependent mechanism.
23334651 2013 Serum cytokines correlated with the disease severity of generalized pustular psoriasis.
23333893 2012 Serum interleukin--4 and tumor necrosis factor alpha concentrations in children with primary acid gastroesophageal reflux and acid gastroesophageal reflux secondary to cow's milk allergy.
23306429 2013 Proinflammatory, anti-inflammatory cytokines and adiponkines in students with central obesity.
23276701 2013 A one year longitudinal study of cytokine genes and depression in breast cancer.
23259293 2012 [Comparative study of IL-4, IFN-gamma gene methylation for the epigenetics of allergic rhinitis in Xinjiang Uygur, Han people].
23245479 2012 The association between the IL-4, ADR?2 and ADAM 33 gene polymorphisms and asthma in the Taiwanese population.
23234779 2012 [Levels of nerve growth factor and interleukin-4 in the induced sputum of children with cough variant asthma].
23222300 2012 Cytokine stimulation of epithelial cancer cells: the similar and divergent functions of IL-4 and IL-13.
23185315 2012 Early-life gut bacteria associate with IL-4-, IL-10- and IFN-? production at two years of age.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
23124025 2013 IL-4 and IL-13 employ discrete signaling pathways for target gene expression in alternatively activated monocytes/macrophages.
23110190 2012 IL-4 haplotype -590T, -34T and intron-3 VNTR R2 is associated with reduced malaria risk among ancestral indian tribal populations.
23107766 2013 Association between IL-4 polymorphism and acute rejection of solid organ allograft: a meta-analysis.
23087426 2012 IL-4 in the brain: a cytokine to remember.
23070918 2013 Association between the interleukin-4, interleukin-13 polymorphisms and asthma: a meta-analysis.
22997428 2012 Identification of new autoantigens by protein array indicates a role for IL4 neutralization in autoimmune hepatitis.
22992805 2013 IL-4 inhibits the melanogenesis of normal human melanocytes through the JAK2-STAT6 signaling pathway.
22986179 2012 Association of IL-10, IL-4, and IL-28B gene polymorphisms with spontaneous clearance of hepatitis C virus in a population from Rio de Janeiro.
22942430 2012 Negative regulation of NKG2D expression by IL-4 in memory CD8 T cells.
22921153 2013 Physical health and incident late-life depression: modification by cytokine genes.
22892939 2013 IL-9-producing invariant NKT cells protect against DSS-induced colitis in an IL-4-dependent manner.
22884982 2012 Polymorphisms in the IL4 gene, smoking, and rhinoconjunctivitis in Japanese women: the Kyushu Okinawa Maternal and Child Health Study.
22875803 2012 Host factor transcriptional regulation contributes to preferential expression of HIV type 1 in IL-4-producing CD4 T cells.
22824342 2012 Association of polymorphisms of cytokine and TLR-2 genes with long-term immunity to hepatitis B in children vaccinated early in life.
22805115 2012 Secondhand smoke exposure and serum cytokine levels in healthy children.
22805022 2012 [Association of susceptibility to chronic rhinosinusitis with genetic polymorphisms of IL-4 and IL-10].
22705603 Association of interleukin 4 (-590 T/C) and interleukin 4 receptor (Q551R A/G) gene polymorphisms with acne vulgaris.
22675249 2012 Multiple signaling pathways are involved in the interleukine-4 regulated expression of DC-SIGN in THP-1 cell line.
22652416 2012 Interleukin-4 rs2243250 polymorphism is associated with asthma among Caucasians and related to atopic asthma.
22615205 2012 Dendritic cell-specific transcript: dendritic cell marker and regulator of TLR-induced cytokine production.
22594992 Interleukin-4 polymorphisms and response to combination therapy in Egyptian chronic hepatitis C patients.
22583827 2012 Influence of functional genetic polymorphism (-590C/T) in non-small cell lung cancer (NSCLC) development: the paradoxal role of IL-4.
22574929 2012 Inflammation-driven dermal lymphangiogenesis in atopic dermatitis is associated with CD11b+ macrophage recruitment and VEGF-C up-regulation in the IL-4-transgenic mouse model.
22538865 2012 Targeting interleukin-4 in asthma: lost in translation?
22528336 2012 Association study of interleukin-4 polymorphisms with paranoid schizophrenia in the Polish population: a critical approach.
22521249 2012 TH2 cytokines increase kallikrein 7 expression and function in patients with atopic dermatitis.
22512783 2012 Interleukin-4 genetic variants correlate with its transcript and protein levels in patients with vitiligo.
22484276 2012 Effects of cytokine and cytokine receptor gene variation on high anti-HB titers: following up on Taiwan's neonatal hepatitis B immunization program.
22484241 2012 The anti-inflammatory actions of IL-4 in human monocytes are not mediated by IL-10, RP105 or the kinase activity of RIPK2.
22441356 2012 Expression of interleukin-4 and interleukin-13 and their receptors in colorectal cancer.
22406175 2012 STAT6 and JAK1 are essential for IL-4-mediated suppression of prostaglandin production in human follicular dendritic cells: opposing roles of phosphorylated and unphosphorylated STAT6.
22387551 2012 Upregulated protein arginine methyltransferase 1 by IL-4 increases eotaxin-1 expression in airway epithelial cells and participates in antigen-induced pulmonary inflammation in rats.
22366824 Association of interleukin-4 polymorphisms with multiple sclerosis in southeastern Iranian patients.
22365405 2011 The relationship between polymorphisms of interleukin-4 gene and silicosis.
22358381 2012 The relationship between Th1/Th2 balance and 1?,25-dihydroxyvitamin D? in patients with nasal polyposis.
22249152 2012 Natural production and functional effects of alternatively spliced interleukin-4 protein in asthma.
22227092 2012 Genetic variability of interleukin4 gene in Taiwanese children with biliary atresia.
22226971 2012 Coordinated regulation of IL-4 and IL-13 expression in human T cells: 3C analysis for DNA looping.
22214155 2011 [Case-control study of relationship between polymorphisms of interleukin-4 gene and susceptibility of silicosis].
22174091 2012 IL-4 induces proliferation in prostate cancer PC3 cells under nutrient-depletion stress through the activation of the JNK-pathway and survivin up-regulation.
22170601 2012 The polymorphisms of IL-4, IL-4R and IL-13 genes and bladder cancer risk in a Chinese population: a case-control study.
22157213 2012 Effect of anti-inflammatory (IL-4, IL-10) cytokine genes in relation to risk of cervical carcinoma.
22156341 2012 Rapid in vivo conversion of effector T cells into Th2 cells during helminth infection.
22143036 2012 The association between IFN-? and IL-4 genetic polymorphisms and childhood susceptibility to bronchial asthma.
22142023 2012 Interleukin-4 -590T/C polymorphism influences the susceptibility to nonsmall cell lung cancer.
22104567 2011 IL-4 and TNF-? polymorphisms are associated with risk of multiple superficial tumors or carcinoma in situ development.
22092872 2012 Interleukin-4 and interleukin-13 prime migrational responses of haemopoietic progenitor cells to stromal cell-derived factor-1?.
22087298 2011 Association study on IL4, IL13 and IL4RA polymorphisms in mite-sensitized persistent allergic rhinitis in a Chinese population.
22053598 2011 Association of TGF-beta1, IL-4 and IL-13 gene polymerphisms with asthma in a Chinese population.
22045834 2012 Polymorphisms in the interleukin 4, interleukin 13, and corresponding receptor genes are not associated with systemic sclerosis and do not influence gene expression.
21989417 2012 A novel mechanism for ERK-dependent regulation of IL4 transcription during human Th2-cell differentiation.
21966389 2011 IL-4 amplifies the pro-inflammatory effect of adenosine in human mast cells by changing expression levels of adenosine receptors.
21913997 2011 Association of polymorphisms in genes encoding IL-4, IL-13 and their receptors with atopic dermatitis in a Korean population.
21890374 2011 Interferon regulatory factor-4 activates IL-2 and IL-4 promoters in cooperation with c-Rel.
21857939 2011 Associations of IL-4, IL-4R, and IL-13 gene polymorphisms in coal workers' pneumoconiosis in China: a case-control study.
21846818 2011 Genetic variants in the LEPR, CRY1, RNASEL, IL4, and ARVCF genes are prognostic markers of prostate cancer-specific mortality.
21819409 2011 Gene-vitamin D interactions on food sensitization: a prospective birth cohort study.
21799768 2011 Enhanced chromatin accessibility and recruitment of JUNB mediate the sustained IL-4 expression in NFAT1 deficient T helper 2 cells.
21788379 2011 Functional and phenotypic characteristics of alternative activation induced in human monocytes by interleukin-4 or the parasitic nematode Brugia malayi.
21771210 2011 Functional variants of IL4 and IL6 genes and risk of tobacco-related oral carcinoma in high-risk Asian Indians.
21755390 2011 Endogenously activated interleukin-4 differentiates disease progressors and non-progressors in tuberculosis susceptible families: a 2-year biomarkers follow-up study.
21749213 2011 Interleukin 4-590T/C polymorphism and susceptibility to leprosy.
21729106 2011 Interleukin 4, interleukin 4 receptor-? and interleukin 10 gene polymorphisms in Chagas disease.
21713407 2012 Association of interleukin 4 VNTR polymorphism and HIV/AIDS in a north Indian seropositive patients.
21690322 2011 Thymic stromal lymphopoietin is produced by dendritic cells.
21658970 2011 Increased interleukin-4 and decreased interferon-? levels in serum of children with asthma.
21646796 2011 Zinc finger protein, multitype 1, suppresses human Th2 development via downregulation of IL-4.
21645924 2011 Interleukin(IL)-4 promotion of CXCL-8 gene transcription is mediated by ERK1/2 pathway in human pulmonary artery endothelial cells.
21644211 2011 Association of variable number of tandem repeats polymorphism in the IL-4 gene with end-stage renal disease in Malaysian patients.
21640045 Association of interleukin-2, interleukin-4 and transforming growth factor-beta gene polymorphisms with Behcet's disease.
21636115 2011 Downregulation of basophil-derived IL-4 and in vivo T(H)2 IgE responses by serotonin and other organic cation transporter 3 ligands.
21611195 2011 GATA3 expression is decreased in psoriasis and during epidermal regeneration; induction by narrow-band UVB and IL-4.
21501388 2011 Association between interleukin-4 gene polymorphisms and intracerebral haemorrhage in Korean population.
21478113 2010 Anti-inflammatory plasma cytokines in children and adolescents with Down syndrome.
21471214 2011 Differential use of chondroitin sulfate to regulate hyaluronan binding by receptor CD44 in Inflammatory and Interleukin 4-activated Macrophages.
21460743 2011 Association of interleukin 4 -589T/C polymorphism with T(H)1 and T(H)2 bias and sepsis in Chinese major trauma patients.
21354455 2011 IL4 gene polymorphisms and their relation to periodontal disease in a Macedonian population.
21323696 2011 Interleukin-4 gene polymorphisms confer Behçet's disease in Turkish population.
21276216 2011 The involvement of interleukin-1 and interleukin-4 in the response of human annulus fibrosus cells to cyclic tensile strain: an altered mechanotransduction pathway with degeneration.
21270410 2011 Basophils are the major producers of IL-4 during primary helminth infection.
21268015 2011 Counter-regulation mechanism of IL-4 and IFN-? signal transduction through cytosolic retention of the pY-STAT6:pY-STAT2:p48 complex.
21211660 2011 Sequence variation in the IL4 gene and resistance to Trypanosoma cruzi infection in Bolivians.
21198753 2011 Production of interleukin-13 is influenced by the interleukin-4 -34TT and -590TT genotype in patients with aggressive periodontitis.
21195738 2011 Association of an IL-4 gene haplotype with Graves disease in children: experimental study and meta-analysis.
21191414 2011 IL-4 and IL-13 alter plasmacytoid dendritic cell responsiveness to CpG DNA and herpes simplex virus-1.
21149635 2011 Monocytic cells derived from human embryonic stem cells and fetal liver share common differentiation pathways and homeostatic functions.
21133811 2011 Cytokine and chemokine responses to selected early secreted antigenic target-6 and culture filtrate protein-10 peptides in tuberculosis.
21127885 2011 Serum concentrations of interleukin-4 and interferon-gamma in relation to severe left ventricular dysfunction in patients with acute myocardial infarction undergoing percutaneous coronary intervention.
21111725 2011 A novel tailed primers protocol to identify the association of IL-4 and IL-1RN (receptor antagonist) gene variable number of tandem repeats polymorphisms with ischemic stroke in Chinese Han population.
21106524 2011 PTB-associated splicing factor (PSF) functions as a repressor of STAT6-mediated Ig epsilon gene transcription by recruitment of HDAC1.
21106245 2011 Akt cross-links IL-4 priming, stem cell factor signaling, and IgE-dependent activation in mature human mast cells.
21086908 2010 Cytokine gene polymorphisms in sarcoidosis.
21071541 2011 Risk of cervical cancer associated with allergies and polymorphisms in genes in the chromosome 5 cytokine cluster.
21067483 2010 Genetic susceptibility to Graves' ophthalmopathy: The role of polymorphisms in anti-inflammatory cytokine genes.
21061265 2011 Hodgkin disease risk: role of genetic polymorphisms and gene-gene interactions in inflammation pathway genes.
21054877 2010 Inflammation gene variants and susceptibility to albuminuria in the U.S. population: analysis in the Third National Health and Nutrition Examination Survey (NHANES III), 1991-1994.
21048327 2010 Cytokine genetic polymorphisms and susceptibility to Kawasaki disease in Taiwanese children.
20980261 2011 Inhibition of suppressive T cell factor 1 (TCF-1) isoforms in naive CD4+ T cells is mediated by IL-4/STAT6 signaling.
20970781 2011 Adipose derived stem cells (ASCs) isolated from breast cancer tissue express IL-4, IL-10 and TGF-?1 and upregulate expression of regulatory molecules on T cells: do they protect breast cancer cells from the immune response?
20942272 2010 Helicobacter pylori infection and cytokine gene polymorphisms in Uzbeks.
20921925 2010 Effect of single nucleotide polymorphisms within the interleukin-4 promoter on aspirin intolerance in asthmatics and interleukin-4 promoter activity.
20880001 2011 Functional polymorphisms of interleukin 4 and interleukin 10 may predict evolution and functional outcome of an ischaemic stroke.
20859068 2010 Induction of RhoA gene expression by interleukin-4 in cultured human bronchial smooth muscle cells.
20852371 2010 Interleukin-4 gene polymorphisms in type 2 diabetic patients with nephropathy.
20839488 2010 Cytokine gene polymorphisms and risk for upper respiratory symptoms in highly-trained athletes.
20814620 2010 In vitro propagation and dynamics of T cells from skin biopsies by methods using interleukins-2 and -4 or anti-CD3/CD28 antibody-coated microbeads.
20811626 2010 Genetic variants in inflammation-related genes are associated with radiation-induced toxicity following treatment for non-small cell lung cancer.
20808855 2010 Fatty acid amide hydrolase in prostate cancer: association with disease severity and outcome, CB1 receptor expression and regulation by IL-4.
20736038 2010 Association of STR polymorphisms in CMA1 and IL-4 with asthma and atopy: the SAPALDIA cohort.
20726231 2010 [Effects of retinoic acid receptor agonist and retinoid X receptor agonist on the expression of IL-4 and IFN-gamma in cord blood mononuclear cells].
20723894 2010 Low-intensity exercise enhances expression of markers of alternative activation in circulating leukocytes: roles of PPAR? and Th2 cytokines.
20719954 2010 Kaposi's sarcoma-associated herpesvirus inhibits interleukin-4-mediated STAT6 phosphorylation to regulate apoptosis and maintain latency.
20716621 2010 Genetic polymorphisms in adaptive immunity genes and childhood acute lymphoblastic leukemia.
20713631 2010 Interleukin-4 regulates the expression of CD209 and subsequent uptake of Mycobacterium leprae by Schwann cells in human leprosy.
20711808 2010 Polymorphisms in oxidative stress and inflammation pathway genes, low-dose ionizing radiation, and the risk of breast cancer among US radiologic technologists.
20703737 2012 The association forecasting of 13 variants within seven asthma susceptibility genes on 3 serum IgE groups in Taiwanese population by integrating of adaptive neuro-fuzzy inference system (ANFIS) and classification analysis methods.
20673868 2010 A genetic association study of maternal and fetal candidate genes that predispose to preterm prelabor rupture of membranes (PROM).
20644561 2011 A large-scale candidate gene approach identifies SNPs in SOD2 and IL13 as predictive markers of response to preoperative chemoradiation in rectal cancer.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20620947 2010 Genome-wide profiling of interleukin-4 and STAT6 transcription factor regulation of human Th2 cell programming.
20618516 2010 Association of IL-4 -590 T>C polymorphism and risk of renal cell carcinoma in a Chinese population.
20603050 2010 A 3-factor epistatic model predicts digital ulcers in Italian scleroderma patients.
20603037 2010 Single nucleotide polymorphisms in inflammation-related genes are associated with venous thromboembolism.
20580039 2010 Association of interleukin-4 promoter polymorphisms in Taiwanese patients with type 2 diabetes mellitus.
20568250 2010 Common single nucleotide polymorphisms in immunoregulatory genes and multiple myeloma risk among women in Connecticut.
20565368 2010 The IFN-gamma allele is correlated to moderate-to-severe acute graft-versus-host disease after allogeneic stem cell transplant.
20554961 2010 Cutting edge: Type I IFN reverses human Th2 commitment and stability by suppressing GATA3.
20536507 2010 Independent predictive roles of eotaxin Ala23Thr, paraoxonase 2 Ser311Cys and beta-adrenergic receptor Trp64Arg polymorphisms on cardiac disease in Type 2 Diabetes--an 8-year prospective cohort analysis of 1297 patients.
20533927 2010 Serum interferon-gamma/interleukin-4 imbalance in patients with Eales' disease.
20530519 2010 Interleukin 4 and STAT6 gene polymorphisms are associated with systemic lupus erythematosus in Chinese patients.
20525402 2010 Analysis of eight genes modulating interferon gamma and human genetic susceptibility to tuberculosis: a case-control association study.
20524005 2010 Association of IL-4 and ADAM33 gene polymorphisms with asthma in an Indian population.
20517665 2010 Association of Q551R polymorphism in the interleukin 4 receptor gene with nonatopic asthma in Slovenian children.
20506498 2010 Survivin is regulated by interleukin-4 in colon cancer stem cells.
20503287 2010 Interleukin-9 polymorphism in infants with respiratory syncytial virus infection: an opposite effect in boys and girls.
20485362 2010 Association analysis of susceptibility candidate region on chromosome 5q31 for tuberculosis.
20459687 2010 Candidate malaria susceptibility/protective SNPs in hospital and population-based studies: the effect of sub-structuring.
20453000 2010 A Large-scale genetic association study of esophageal adenocarcinoma risk.
20452482 2010 Identification of fetal and maternal single nucleotide polymorphisms in candidate genes that predispose to spontaneous preterm labor with intact membranes.
20444155 2010 Joint influences of Acidic-Mammalian-Chitinase with Interleukin-4 and Toll-like receptor-10 with Interleukin-13 in the genetics of asthma.
20442634 2010 APOE epsilon4 and MBL-2 O/O genotypes are associated with neurocognitive impairment in HIV-infected plasma donors.
20424473 2010 L-type voltage-dependent calcium channel alpha subunit 1C is a novel candidate gene associated with secondary hyperparathyroidism: an application of haplotype-based analysis for multiple linked single nucleotide polymorphisms.
20418110 2010 Polymorphisms in cytokine genes and serum cytokine levels among New Mexican women with and without breast cancer.
20416077 2010 Identification of type 2 diabetes-associated combination of SNPs using support vector machine.
20413987 2010 Genetic polymorphisms of ADRB2 and IL10 may be associated with the risk of IgE sensitization to digestive powders in exposed medical personnel.
20406299 2010 The anti-inflammatory effects of interleukin-4 are not mediated by suppressor of cytokine signalling-1 (SOCS1).
20403914 2010 Comprehensive analysis of the cytokine-rich chromosome 5q31.1 region suggests a role for IL-4 gene variants in prostate cancer risk.
20395963 2010 Replication of genetic association studies in asthma and related phenotypes.
20394509 2010 Association and gene-gene interactions of eight common single-nucleotide polymorphisms with pediatric asthma in middle china.
20367137 2010 Dysregulation in T helper 1/T helper 2 cytokine ratios in patients with multiple myeloma.
20364398 2010 VEGF and IL-4 gene variability and its association with the risk of coronary heart disease in north Indian population.
20349753 2009 Association of 22 cytokine gene polymorphisms with tuberculosis in Macedonians.
20349326 2010 Role of NADPH oxidase in interleukin-4-induced monocyte chemoattractant protein-1 expression in vascular endothelium.
20332709 2010 Association analysis of polymorphisms in IL-3, IL-4, IL-5, IL-9, and IL-13 with Graves' disease.
20305143 2010 Impact of genomic risk factors on outcome after hematopoietic stem cell transplantation for patients with chronic myeloid leukemia.
20304823 2010 IL-4 and TGF-beta 1 counterbalance one another while regulating mast cell homeostasis.
20299965 2010 Cytokine signaling pathway polymorphisms and AIDS-related non-Hodgkin lymphoma risk in the multicenter AIDS cohort study.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20222161 2010 Influence of interleukin polymorphisms on development of gastric cancer and peptic ulcer.
20219689 2010 Interleukin-4/interleukin-4 receptor gene polymorphisms in hand osteoarthritis.
20217044 2010 Clinical relevance of 13 cytokine gene polymorphisms in Chinese major trauma patients.
20213229 2010 Cytokine polymorphisms and Alzheimer disease: possible associations.
20192866 2010 Polymorphisms and haplotypes in the interleukin-4 gene are associated with chronic periodontitis in a Brazilian population.
20184663 2011 Tumour-associated fibroblasts and mesenchymal stem cells: more similarities than differences.
20177758 2010 T-helper 1, T-helper 2, and T-regulatory cytokines gene polymorphisms in irritable bowel syndrome.
20147633 2010 IL-4 regulates skin homeostasis and the predisposition toward allergic skin inflammation.
20145925 2010 C-reactive protein -717C>T genetic polymorphism associates with esophagectomy-induced stress hyperglycemia.
20140262 2010 Maternal and fetal genetic associations of PTGER3 and PON1 with preterm birth.
20139223 2010 Airway wall expression of OX40/OX40L and interleukin-4 in asthma.
20128416 2009 Polymorphisms in IL4 and iLARA confer susceptibility to asthma.
20121760 2010 Dynamics in cytokine responses during the development of occupational sensitization to rats.
20112007 2010 Interleukin-4 up-regulates histamine H1 receptors by activation of H1 receptor gene transcription.
20100010 2010 The expression of IFN-gamma, IL-4, Foxp3 and perforin genes are not correlated with DNA methylation status in patients with immune thrombocytopenic purpura.
20093796 2009 Activation of signal transducer and activator of transcription factor 1 by interleukins-13 and -4 in cultured human bronchial smooth muscle cells.
20082482 2010 Immunogenetic characteristics of patients with autoimmune gastritis.
20059579 2010 Regulation of eotaxin-3/CCL26 expression in human monocytic cells.
20056178 2010 Polymorphisms in innate immunity genes and patients response to dendritic cell-based HIV immuno-treatment.
20053586 2010 Interleukin-4 inhibits an early phase in the HIV-1 life cycle in the human colorectal cell line HT-29.
20049266 2009 Detection of R576 interleukin-4 receptor an allele gene, serum interleukin-4, and eosinophilic cationic protein in atopic dermatitis patients.
20039421 2010 1,25-dihydroxyvitamin D3 modulates Th17 polarization and interleukin-22 expression by memory T cells from patients with early rheumatoid arthritis.
20030788 2010 Polymorphisms of cytotoxic T lymphocyte-associated antigen-4 and cytokine genes in Taiwanese patients with ankylosing spondylitis.
20027321 2009 Allelic polymorphism of cytokine genes during pulmonary tuberculosis.
20016407 2010 Polymorphisms in PARP, IL1B, IL4, IL10, C1INH, DEFB1, and DEFA4 in meningococcal disease in three populations.
20010912 Differential requirements for IL-4/STAT6 signalling in CD4 T-cell fate determination and Th2-immune effector responses.
20003246 2009 IL4 gene polymorphism and previous malaria experiences manipulate anti-Plasmodium falciparum antibody isotype profiles in complicated and uncomplicated malaria.
19959237 2010 The interleukin-4 -34TT and -590TT genotype is correlated with increased expression and protein production in aggressive periodontitis.
19948975 2009 Integrative predictive model of coronary artery calcification in atherosclerosis.
19938203 2009 Polymorphisms of some cytokines and chronic hepatitis B and C virus infection.
19933216 2010 The COPD genetic association compendium: a comprehensive online database of COPD genetic associations.
19915002 2010 Early growth response protein-1 (Egr-1) is preferentially expressed in T helper type 2 (Th2) cells and is involved in acute transcription of the Th2 cytokine interleukin-4.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19910025 2009 Sequencing the IL4 locus in African Americans implicates rare noncoding variants in asthma susceptibility.
19892918 2009 Genetic risk factors for periodontitis in a Japanese population.
19882211 2010 Gene polymorphisms of interleukin-4, interleukin-10 and transforming growth factor-beta in Graves' disease.
19878651 2009 Regulation of interleukin-4 signaling by extracellular reduction of intramolecular disulfides.
19862939 2009 Single-nucleotide polymorphisms in genes predisposing to asthma in children of Chinese Han nationality.
19860911 2009 Variation in cytokine genes can contribute to severity of acetabular osteolysis and risk for revision in patients with ABG 1 total hip arthroplasty: a genetic association study.
19857574 2010 Interleukin-4 upregulates RhoA protein via an activation of STAT6 in cultured human bronchial smooth muscle cells.
19845895 2009 Fine mapping of the CELIAC2 locus on chromosome 5q31-q33 in the Finnish and Hungarian populations.
19840389 2009 Identification of a haplotype block in the 5q31 cytokine gene cluster associated with the susceptibility to severe malaria.
19835477 2009 Genetic evidence for the aggravation of Plasmodium falciparum malaria by interleukin 4.
19818512 2009 A novel exonic variant (221delT) in the LGALS13 gene encoding placental protein 13 (PP13) is associated with preterm labour in a low risk population.
19817957 2009 Secreted protein acidic and rich in cysteine (SPARC) gene polymorphism association with hepatocellular carcinoma in Italian patients.
19811408 2009 Involvement of T(H)1/T(H)2 cytokines in the pathogenesis of autoimmune skin disease-Pemphigus vulgaris.
19804407 2010 Oct-1 is responsible for the C-33T polymorphism effect in the IL-4 promoter.
19799628 2009 Correlation of parasitic load with interleukin-4 response in patients with cutaneous leishmaniasis due to Leishmania tropica.
19773451 2009 Role of inflammation gene polymorphisms on pain severity in lung cancer patients.
19773279 2009 Association between genetic variants in VEGF, ERCC3 and occupational benzene haematotoxicity.
19772762 Several interleukin-4 and interleukin-13 gene single nucleotide polymorphisms among Chinese asthmatic patients.
19762488 2009 GM-CSF and IL-4 induce dendritic cell differentiation and disrupt osteoclastogenesis through M-CSF receptor shedding by up-regulation of TNF-alpha converting enzyme (TACE).
19753334 2009 TGF-beta(1), IL-10 and IL-4 in colostrum of allergic and nonallergic mothers.
19735490 2009 Natural killer T cells expressing IFN-gamma and IL-4 in lesional skin of atopic eczema.
19726720 2009 Alternatively activated macrophages engage in homotypic and heterotypic interactions through IL-4 and polyamine-induced E-cadherin/catenin complexes.
19721012 2009 Reciprocal role of GATA-1 and vitamin D receptor in human myeloid dendritic cell differentiation.
19718824 2009 [Allelic polymorphism of the IL-2and IL-4 genes in herpesvirus infection].
19718656 2009 Upregulation of MUC5AC gene expression by IL-4 through CREB in human airway epithelial cells.
19707465 2008 Association of pro/anti-inflammatory cytokine gene variants in renal transplant patients with allograft outcome and cyclosporine immunosuppressant levels.
19706316 2010 Differential modulation of CCR5-tropic human immunodeficiency virus-1 transfer from macrophages towards T cells under interleukin-4/interleukin-13 microenvironment.
19699526 2009 Regulation of expression and secretion of galectin-3 in human monocyte-derived dendritic cells.
19698128 2009 Modulation of cytokines and transcription factors (T-Bet and GATA3) in CD4 enriched cervical cells of Chlamydia trachomatis infected fertile and infertile women upon stimulation with chlamydial inclusion membrane proteins B and C.
19692168 2010 Genetic susceptibility to distinct bladder cancer subphenotypes.
19683555 2009 Role of human leukocyte antigen, killer-cell immunoglobulin-like receptors, and cytokine gene polymorphisms in leptospirosis.
19682920 2009 Interferon-gamma and interleukin-4 single nucleotide gene polymorphisms in Paracoccidioidomycosis.
19657367 2009 Genetic polymorphisms of EPHX1, Gsk3beta, TNFSF8 and myeloma cell DKK-1 expression linked to bone disease in myeloma.
19625176 2009 PTEN identified as important risk factor of chronic obstructive pulmonary disease.
19594368 2009 Distribution of cytokine gene polymorphisms in the general Lebanese population: the first report.
19586939 2009 Changes in cytokine profile pre- and post-immunosuppression in acquired aplastic anemia.
19586918 2009 Distinct structural requirements for interleukin-4 (IL-4) and IL-13 binding to the shared IL-13 receptor facilitate cellular tuning of cytokine responsiveness.
19578876 2009 The ERAP2 gene is associated with preeclampsia in Australian and Norwegian populations.
19575932 2009 [Correlation of IL-4 and IL-13 gene polymorphisms with asthma and total serum IgE levels].
19573080 2009 Common genetic variants in candidate genes and risk of familial lymphoid malignancies.
19566553 2009 Genetic susceptibility to viral exposure may increase the risk of cerebral palsy.
19559392 2009 A candidate gene association study of 77 polymorphisms in migraine.
19555572 2009 [Single nucleotide polymorphism in asthma predisposing genes in children in Shanghai].
19552791 2010 Reduced IFN-gamma- and enhanced IL-4-producing CD4+ cord blood T cells are associated with a higher risk for atopic dermatitis during the first 2 yr of life.
19544973 2009 Breast cancer risk associated with polymorphisms of IL-1RN and IL-4 gene in Indian women.
19544559 2009 Synergistic effect of HLA class II loci and cytokine gene polymorphisms on the risk of gastric cancer in Japanese patients with Helicobacter pylori infection.
19541591 2009 Involvement of IL-10 and IL-4 in evasion strategies of Echinococcus granulosus to host immune response.
19536153 2009 Sex-specific effect of IL9 polymorphisms on lung function and polysensitization.
19527514 2009 Racial disparity in pathophysiologic pathways of preterm birth based on genetic variants.
19521787 2009 Chromatin structure and DNA methylation of the IL-4 gene in human T(H)2 cells.
19515749 2009 Favorable impact of the interleukin-4 receptor allelic variant I75 on the survival of diffuse large B-cell lymphoma patients demonstrated in a large prospective clinical trial.
19508433 2009 Genetic variants in immunoregulatory genes and risk for childhood lymphomas.
19505916 2009 Cytokine and cytokine receptor single-nucleotide polymorphisms predict risk for non-small cell lung cancer among women.
19497039 2009 Role of non-HLA genetic variants in end-stage renal disease.
19495883 2009 CRP genetic polymorphism is associated with lymph node metastasis in thoracic esophageal squamous cell cancer.
19479237 2009 Phenotype-genotype interactions on renal function in type 2 diabetes: an analysis using structural equation modelling.
19470040 2010 TNF-alpha and IL-10 gene polymorphisms show a weak association with pemphigus vulgaris in the Slovak population.
19437232 2009 Cytokines profiles in Sudanese women with preeclampsia.
19426601 2009 [The influences of camel milk on the immune response of chronic hepatitis B patients].
19421745 2009 Polymorphisms and haplotype analysis of IL-4Ralpha Q576R and I75V in patients with penicillin allergy.
19419769 2009 IL-4 alters expression patterns of storage components of vascular endothelial cell-specific granules through STAT6- and SOCS-1-dependent mechanisms.
19409508 Impact of the IL-4 -590 C/T transition on the levels of Plasmodium falciparum specific IgE, IgG, IgG subclasses and total IgE in two sympatric ethnic groups living in Mali.
19408823 2009 Distribution of the 22 cytokine gene polymorphisms in healthy Macedonian population.
19385959 2009 Counter regulation of the high affinity IgE receptor, FcepsilonRI, on human airway dendritic cells by IL-4 and IL-10.
19382262 2009 Association of IL-4 589 C/T promoter and IL-4RalphaI50V receptor polymorphism with susceptibility to HIV-1 infection in North Indians.
19375306 2009 Meta-analysis of genetic polymorphisms and gastric cancer risk: variability in associations according to race.
19372547 2009 Opposing control of rhabdomyosarcoma growth and differentiation by myogenin and interleukin 4.
19370405 2009 IFN-gamma and IL-4 in saliva of patients with oral lichen planus: a study in an ethnic Chinese population.
19351467 2009 [Relationship between gene polymorphism of CYP2E1, CYP1A1, IL-4 and medicamentosa-like dermatitis induced by trichloroethylene].
19347053 2009 Analysis of inflammation- and atherosclerosis-related gene polymorphisms in branch retinal vein occlusion.
19346497 2009 IFN-lambda1 (IL-29) inhibits GATA3 expression and suppresses Th2 responses in human naive and memory T cells.
19336370 2009 Determination of genetic predisposition to patent ductus arteriosus in preterm infants.
19332998 2009 Association of interleukin-13/-4 and toll-like receptor 10 with preterm births.
19332120 2009 Effect of desensitization in solid organ transplant recipients depends on some cytokines genes polymorphism.
19279357 2009 Association of cytokine gene polymorphisms with chronic obstructive pulmonary disease in Macedonians.
19264973 2009 Assessing the reproducibility of asthma candidate gene associations, using genome-wide data.
19263529 2009 Genetic risk factors in recurrent venous thromboembolism: A multilocus, population-based, prospective approach.
19262574 2009 Genome-wide association scan yields new insights into the immunopathogenesis of psoriasis.
19261373 2009 Relationship between recurrent vulvovaginal candidosis and immune mediators in vaginal fluid.
19258923 2009 Genetic susceptibility to respiratory syncytial virus bronchiolitis in preterm children is associated with airway remodeling genes and innate immune genes.
19254294 2009 Contribution of functional variation in the IL13 gene to allergy, hay fever and asthma in the NSHD longitudinal 1946 birth cohort.
19251840 2009 Th2 cytokine-induced upregulation of 11beta-hydroxysteroid dehydrogenase-1 facilitates glucocorticoid suppression of proasthmatic airway smooth muscle function.
19249119 2010 Association of IL-4 and IL-10 gene promoter polymorphisms with common variable immunodeficiency.
19247692 2009 Analyses of associations with asthma in four asthma population samples from Canada and Australia.
19222422 2009 A haplotype in the inducible T-cell tyrosine kinase is a risk factor for seasonal allergic rhinitis.
19200845 2009 Influence of host genetic variation on rubella-specific T cell cytokine responses following rubella vaccination.
19193442 2009 IL-4 increases CD21-dependent infection of pulmonary alveolar epithelial type II cells by EBV.
19190772 2009 Association of the gene polymorphisms IFN-gamma +874, IL-13 -1055 and IL-4 -590 with patterns of reinfection with Schistosoma mansoni.
19185507 2009 Common polymorphisms in interleukin genes (IL4, IL6, IL8 and IL12) are not associated with alcoholic liver disease or alcoholism in Spanish men.
19170196 2009 Polymorphisms in innate immunity genes and lung cancer risk in Xuanwei, China.
19169254 2009 Genome-wide scan reveals association of psoriasis with IL-23 and NF-kappaB pathways.
19168731 2009 The RgpA-Kgp proteinase-adhesin complexes of Porphyromonas gingivalis Inactivate the Th2 cytokines interleukin-4 and interleukin-5.
19164348 2009 FcepsilonRI-mediated thymic stromal lymphopoietin production by interleukin-4-primed human mast cells.