Property Summary

NCBI Gene PubMed Count 1,070
PubMed Score 9218.99
PubTator Score 6054.65

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Allergic hypersensitivity disease 126 6.502 3.3
Dermatitis 157 6.363 3.2
Hypereosinophilic syndrome 71 6.203 3.1
Allergic rhinitis 94 6.01 3.0
Cancer 2499 5.756 2.9
Hypersensitivity reaction type II disease 253 5.69 2.8
Leishmaniasis 47 5.483 2.7
Arthritis 290 5.414 2.7
Schistosomiasis 35 5.086 2.5
Multiple Sclerosis 540 5.077 2.5
Inflammatory bowel disease 151 4.964 2.5
Tetanus 68 4.913 2.5
tuberculosis 2010 4.897 2.4
Lung disease 142 4.862 2.4
Primary immunodeficiency disease 54 4.51 2.3
Malaria 160 4.368 2.2
Vascular disease 319 4.307 2.2
diabetes mellitus 1728 4.269 2.1
Common cold 67 4.217 2.1
Acquired immunodeficiency syndrome 197 4.151 2.1
periodontitis 293 4.131 2.1
Hepatitis 67 4.115 2.1
Conjunctivitis 53 3.973 2.0
Influenza 142 3.956 2.0
Kidney disease 430 3.925 2.0
Collagen disease 27 3.825 1.9
Myocarditis 18 3.777 1.9
Filariasis 21 3.775 1.9
Hepatitis B 108 3.744 1.9
Keratoconjunctivitis 14 3.704 1.9
Uveitis 103 3.655 1.8
Hepatitis C 94 3.632 1.8
Aspergillosis 26 3.6 1.8
Leprosy 73 3.556 1.8
Paracoccidioidomycosis 12 3.469 1.7
Brucellosis 24 3.44 1.7
Gastritis 47 3.432 1.7
Trichinosis 7 3.417 1.7
Mastocytosis 27 3.395 1.7
Encephalitis 64 3.325 1.7
Anemia 365 3.309 1.7
Cryptococcosis 18 3.302 1.7
Toxoplasmosis 17 3.282 1.6
Neuropathy 261 3.269 1.6
Urticaria 67 3.269 1.6
Candidiasis 55 3.21 1.6
Chagas disease 39 3.194 1.6
Kawasaki disease 28 3.165 1.6
Pertussis 20 3.12 1.6
Sinusitis 65 3.089 1.5
Lichen planus 16 3.086 1.5
Echinococcosis 26 3.005 1.5
sarcoidosis 370 3.004 1.5

Expression

PDB (27)

Gene RIF (1161)

AA Sequence

MGLTSQLLPPLFFLLACAGNFVHGHKCDITLQEIIKTLNSLTEQKTLCTELTVTDIFAASKNTTEKETFC      1 - 70
RAATVLRQFYSHHEKDTRCLGATAQQFHRHKQLIRFLKRLDRNLWGLAGLNSCPVKEANQSTLENFLERL     71 - 140
KTIMREKYSKCSS                                                             141 - 153
//

Text Mined References (1070)

PMID Year Title