Property Summary

NCBI Gene PubMed Count 20
PubMed Score 74.81
PubTator Score 34.23

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
nephrosclerosis 1.276 3.9e-04
malignant mesothelioma 3.900 3.0e-08
cutaneous lupus erythematosus 1.300 2.6e-02
osteosarcoma -1.807 7.4e-03
medulloblastoma -1.300 2.4e-02
medulloblastoma, large-cell -2.400 6.2e-05
Atopic dermatitis 1.200 1.4e-03
colon cancer 1.500 1.1e-02
interstitial cystitis 1.800 2.1e-03
pilocytic astrocytoma 1.700 4.1e-04
primary Sjogren syndrome 1.100 1.3e-02
Breast cancer 1.600 3.3e-02
ulcerative colitis 1.100 1.3e-03
ovarian cancer 1.600 1.1e-03

Gene RIF (14)

PMID Text
26649511 Findings demonstrated that IL-27 and IL-27R were elevated in multiple sclerosis lesions and that local IL-27 can modulate immune properties of astrocytes and infiltrating immune cells
26282876 The significant expression of IL-27 in TB and the negative influence of IL-27R on T cell function demonstrate the pathway by which this cytokine/receptor pair is detrimental in TB.
24771852 natural sIL-27Ralpha binds rIL-27, inhibits IL-27 binding to its cell surface receptor, and is a potent inhibitor of IL-27 signaling, as shown by its ability to specifically block IL-27-mediated STAT activation, at low molar excess over IL-27.
22936014 Aberrant hypermethylation and reduced expression of IL27RA is associated with myelodysplastic syndromes.
22312192 TCCR/WSX-1 is closely associated with angiogenesis and could serve as a novel therapeutic target in patients with age-related macular degeneration.
21631431 Mutations in the transmembrane and juxtamembrane domains enhance IL27R transforming activity.
20503287 Observational study of gene-disease association. (HuGE Navigator)
19549909 Results reveal an interleukin 27-independent function of WSX1 sensitizing natural killer cell-mediated antitumor surveillance.
19386761 These results indicate that humanin protects neurons by binding to a complex or complexes involving CNTFR/WSX-1/gp130.
19258923 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18003935 IL-27R possesses hematopoietic cell-transforming properties
17703412 Observational study of gene-disease association. (HuGE Navigator)
14764690 WSX-1 together with the cytokine receptor gp130 constitutes a functional signal-transducing receptor for IL-27.
12734330 WSX-1 is essential for transcriptional activation of STAT1 and for augmenting the induction of T-bet expression during initiation of Th1 cell differentiation.

AA Sequence

MRGGRGAPFWLWPLPKLALLPLLWVLFQRTRPQGSAGPLQCYGVGPLGDLNCSWEPLGDLGAPSELHLQS      1 - 70
QKYRSNKTQTVAVAAGRSWVAIPREQLTMSDKLLVWGTKAGQPLWPPVFVNLETQMKPNAPRLGPDVDFS     71 - 140
EDDPLEATVHWAPPTWPSHKVLICQFHYRRCQEAAWTLLEPELKTIPLTPVEIQDLELATGYKVYGRCRM    141 - 210
EKEEDLWGEWSPILSFQTPPSAPKDVWVSGNLCGTPGGEEPLLLWKAPGPCVQVSYKVWFWVGGRELSPE    211 - 280
GITCCCSLIPSGAEWARVSAVNATSWEPLTNLSLVCLDSASAPRSVAVSSIAGSTELLVTWQPGPGEPLE    281 - 350
HVVDWARDGDPLEKLNWVRLPPGNLSALLPGNFTVGVPYRITVTAVSASGLASASSVWGFREELAPLVGP    351 - 420
TLWRLQDAPPGTPAIAWGEVPRHQLRGHLTHYTLCAQSGTSPSVCMNVSGNTQSVTLPDLPWGPCELWVT    421 - 490
ASTIAGQGPPGPILRLHLPDNTLRWKVLPGILFLWGLFLLGCGLSLATSGRCYHLRHKVLPRWVWEKVPD    491 - 560
PANSSSGQPHMEQVPEAQPLGDLPILEVEEMEPPPVMESSQPAQATAPLDSGYEKHFLPTPEELGLLGPP    561 - 630
RPQVLA                                                                    631 - 636
//

Text Mined References (20)

PMID Year Title
26649511 2016 Production of IL-27 in multiple sclerosis lesions by astrocytes and myeloid cells: Modulation of local immune responses.
26282876 2015 Interleukin 27R regulates CD4+ T cell phenotype and impacts protective immunity during Mycobacterium tuberculosis infection.
24771852 2014 A soluble form of IL-27R? is a natural IL-27 antagonist.
22936014 2013 Genome-wide profiling of methylation identifies novel targets with aberrant hypermethylation and reduced expression in low-risk myelodysplastic syndromes.
22312192 2012 TCCR/WSX-1 is a novel angiogenic factor in age-related macular degeneration.
21631431 2011 Mutations in the transmembrane and juxtamembrane domains enhance IL27R transforming activity.
20503287 2010 Interleukin-9 polymorphism in infants with respiratory syncytial virus infection: an opposite effect in boys and girls.
19549909 2009 Expression of WSX1 in tumors sensitizes IL-27 signaling-independent natural killer cell surveillance.
19386761 2009 Humanin inhibits neuronal cell death by interacting with a cytokine receptor complex or complexes involving CNTF receptor alpha/WSX-1/gp130.
19258923 2009 Genetic susceptibility to respiratory syncytial virus bronchiolitis in preterm children is associated with airway remodeling genes and innate immune genes.
18003935 2007 Transformation of hematopoietic cells and activation of JAK2-V617F by IL-27R, a component of a heterodimeric type I cytokine receptor.
17703412 2007 Genetic susceptibility to respiratory syncytial virus bronchiolitis is predominantly associated with innate immune genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14764690 2004 WSX-1 and glycoprotein 130 constitute a signal-transducing receptor for IL-27.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12734330 2003 Cutting edge: role of IL-27/WSX-1 signaling for induction of T-bet through activation of STAT1 during initial Th1 commitment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12121660 2002 IL-27, a heterodimeric cytokine composed of EBI3 and p28 protein, induces proliferation of naive CD4+ T cells.
11057672 2000 Development of Th1-type immune responses requires the type I cytokine receptor TCCR.
9600072 1998 Cloning and characterization of a novel class I cytokine receptor.