Property Summary

NCBI Gene PubMed Count 218
PubMed Score 146.13
PubTator Score 904.09

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
psoriasis 2.000 1.2e-54
tuberculosis -1.100 2.4e-04
lung cancer 2.000 1.1e-04
diabetes mellitus 1.100 1.8e-03
spina bifida -1.669 3.6e-02

Protein-protein Interaction (3)

Gene RIF (196)

PMID Text
27053620 The expression of IL-23 significantly increased in chronic atrophic gastritis with intestinal metaplasia tissues and gastric cancer tissues.
26952371 that consumption of star fruit juice at 100g twice daily for one month can significantly depress the pro-inflammation cytokines: TNF-alpha, IL-23, and NO, while increasing walking distance.
26657845 IL-23 mediates the differentiation of Th17 and Treg cells and the production of associated cytokines in DICs. The potential mechanism likely involves the STAT3 pathway.
26656739 we showed that elevated IL-17/IL-23 serum concentrations helped to discriminate BP patients who later relapsed.
26303210 Data suggest that the toll like receptor 3 (TLR3)-interferon regulatory factor 6 protein (IRF6)-interleukin-23 subunit p19 (p19)/EBI3 protein axis may regulate keratinocyte functions in the skin.
26295034 Our data supports previous reports showing IL-17 and -23 upregulation in association with Multiple sclerosis and potentially identify a previously unknown involvement for CCL27.
26151690 IL-17A, IL-17F and IL23R polymorphisms have no effect on expression of IL-6, IL-17, IL-21 and TGF-beta1 mRNAs expression in H. pylori-infected gastritis.
26062426 IL-23 could promote migration of human ESCC cells by activating DLL4/Notch1 signaling pathway
25887118 potential biomarker for poor therapeutic response in lupus nephritis patients
25877925 mTORC2 regulates lipopolysaccharides-induced expression of IL-12 and IL-23 in human dendritic cells.
25799392 High serum IL-23 levels are associated with rheumatoid arthritis.
25793426 Data suggest that up-regulation of IL17 (interleukin 17), IL23 (interleukin 23), and p73 (tumor protein p73) expression in cutaneous melanoma may be biomarker of melanoma invasiveness.
25789703 There is an association with genetic variants in the IL-23 and NF-kappaB pathways that discriminates between mild and severe psoriasis.
25769911 central role in psoriasis pathogenesis
25769808 IL23 levels are raised in schizophrenia patients prescribed with depot medication, supporting the role of aberrant cytokine signalling in schizophrenia.
25721268 IL-23 plays a pivotal role in the development of oesophageal carcinoma via epithelial-mesenchymal transition.
25670394 IL-23 may play an important role in the development of Graves' disease, and the IL-23A gene is a genetic risk marker for Graves' disease in Han Chinese population.
25649806 IL-23 has a role in disease progression in patients with carotid atherosclerosis, potentially involving IL-17-related mechanisms
25646481 selective IL-4-mediated IL-23/T(H)17 silencing is promising as treatment against harmful inflammation, while sparing the IL-12-dependent T(H)1 responses
25639230 Knocking down the expression of MMP2 in melanoma cells resulted in inhibition of IL-23-induced invasiveness
25626905 Clostridium difficile toxins A and B induce IL-23 mRNA expression in human dendritic cells.
25621490 The IL-23/Th17 pathway may be involved in the pathogenesis of primary immune thrombocytopenia through enhancement of the Th17 response.
25562560 this study is the first to find a clear correlation between high IL-17/IL-23 axis levels and phenotypes of AEDS in children.
25562331 IL-23 level increased significantly in the serum and urine of SLE patients with and without lupus nephritis compared to controls. Urine levels of IL-23 were correlated with the renal SLE Disease Activity Index score and 24-h urinary protein levels.
25553835 this is the first study to report the possible role played by IL-23 and its gene polymorphism in neuro-Behcet's and not only uveitis with a significant relation to disease activity making both potential markers
25525302 IL-23 has a role in regulating IL-17A and/or IL-17F positive Th17 cells in chronic periodontitis
25439430 High gene copy numbers of IL17F and IL23A were associated with Behcet's disease and Vogt-Koyanagi-Harada syndrome.
25371211 The IL-23/IL-23R/IL-12Rbeta1 complex formation does not follow the classical "site I-II-III" architectural paradigm.
25253467 Data iindicate that interleukin-23 (IL-23) is critical for the development of proteoglycan-induced arthritis (PGIA) after subcutaneous but not intraperitoneal induction.
25234720 HIV gp120-induced IL-23 upregulated suppressor of cytokine signaling 1 (SOCS1) protein in T cells, which inhibited IFN-gamma production.
25234720 SOCS1 protein expression is upregulated in T cells cultured with HIV-1 gp120-treated myeloid dendritic cell medium but is significantly inhibited in the presence of anti-IL-23 antibody
25083738 Plasma level of IL-23 in relapsing remitting multiple sclerosis patients was significantly increased compared to control subjects.
25046339 IL-19 as a component of the IL-23/IL-17 axis strengthens the IL-17A action and might be a biomarker for the activity of this axis in chronic inflammatory disorders
25015728 Data indicate that IL-23 p19, IL-23 p40 (IL-12 p40) and IL-23 receptor (IL-23R) were cytoplasmic/membranous over-expressed in colorectal cancer and normal tissues, but were reduced in lymph node metastases.
24995325 Serum IL-17 and IL-23 levels demonstrate no association with type 1 and type 2 diabetes, but, in line with previous studies, TGF-beta levels were lower in type 1 diabetic patients
24990863 High serum interleukin-23 levels are associated with systemic lupus erythematosus.
24982422 zymosan-induced il23a mRNA expression is best explained through coordinated kappaB- and ATF2-dependent transcription; and (iii) il23a expression relies on complementary phosphorylation of ATF2 on Thr-69 and Thr-71 dependent on PKC and MAPK activities.
24957500 genetic variation at IL12B, IL23R and IL23A has an influence not only on the risk for psoriasis but also on disease severity and type 2 diabetes mellitus
24924839 IL-23 levels correlate well with disease activity and functional disability but not with radiographic joint damage in rheumatoid arthritis.
24910175 TSLP synergized with CD40 ligand to promote dendritic cell activation and pathogenic IL-23 production by primary blood and skin dendritic cells.
24909386 preoperative serum IL23 has no outcome prognostic value in patients with colorectal cancer
24899786 the IL-23/IL-17 axis may play a crucial role in the immunopathogenesis pemphigus vulgaris
24796719 balance of IL-23 vs IL-12/IL-27 signals into CD4(+) effector T cells determines whether tissue inflammation is perpetuated or resolves
24781050 1,25D increased the synergistic effect provided by NOD2 and TLR co-activation on interleukin (IL)-10, IL-23, and tumor necrosis factor-alpha (TNF-alpha).
24643777 the IL-23/Th17 axis is involved in the immune response to anthrax in humans.
24577500 In conclusion, here we show that STAT3 activation can be one of the molecular mechanisms leading to KSHV-mediated DC dysfunction, that might allow viral persistence and the onset of KSHV-associated malignancies.
24568095 A review of both experimental and human data that supports the hypothesis of a key pathogenic role of IL-23/Th17 axis in psoriasis.
24384828 IL-23 plays a role in enteropathic arthritis patients with inflammatory bowel disease
24224652 IL-23 does not induce IL-7 expression in microglia and astrocytes.
24067979 Levels of IL-23 produced by CD16+ monocytes from HIV-1-infected subjects in response to E. coli stimulation were higher than those produced by PBMC from uninfected subjects.
24054330 NOD2 influences the composition of the microbiome; it is possible that increased basal IL-23 in the mucosa mediated by loss of miR-29 might facilitate this effect.
24040001 Data indicate that differentially expressed IL-17, IL-22, and IL-23 levels are associated with K-ras in a stage-specific fashion along colorectal cancer progression and an association was established between mutant K-ras and GM-CSF and IFN-gamma.
23910013 The serum levels of IL-23 and IL-17 in Primary biliary cirrhosis patients were positively correlated with serum gamma-glutamyltransferase levels.
23825942 These data provide novel insights into a yet unrecognized mechanism of HBV-induced hepatitis, by which increases in IL-23 expression, through an MR/endocytosis-dependent or -independent manner, produce liver damage through the IL-23/IL-17 axis.
23755218 Poor nutritional status and frailty in subjects over 75 years were associated with decreased IL-12p70 and IL-23 production.
23740229 Autophagy appears to be associated with intestinal modulation of IL-23 in ankylosing spondylitis.
23679818 Data show that IFN-gamma induced the production of IL-12/23p40 and IL-23p19 mRNA as well as IL-12p40 and IL-23 proteins positively regulated by the p38 mitogen-activated protein kinases (MAPKs) in monocytes isolated through anti-CD14 microbeads.
23673284 These data suggest a role for IL23 in the psoriatic arthritis pathogenesis in Romanians.
23579029 findings show the GG haplotype of lL23A variants (rs11171806 and rs2066808) was protective against Type 1 diabetes
23563201 We found attenuated IL-23-induced Th17 response in IL23R A/GLN381 heterozygous individuals.
23520984 Interleukin-23 can be observed and may be associated with inflammatory response and bone resorption in periapical lesions
23489789 The serum IL-23 level was significantly elevated in patients with RA compared to healthy controls.
23472658 this study indicates that the IL-23/IL-17A axis plays a pivotal role in inflammatory bowel diseases pathogenesis through the NO pathway.
23425136 PBMNs and macrophages from healthy subjects with previous ReA show normal inflammasome activation and low TNF-alpha and IL-23 production.
23393581 The findings indicated that genetic variants in IL-23R may contribute to AML risk in our Chinese population.
23388728 These findings suggest that Tim-3-mediated differential regulation of IL-12/IL-23 drives T(H)17 cell development, a milieu favoring viral persistence and autoimmune phenomenon during chronic hepatitis C.
23376980 Interferon-gamma pre-stimulation enhances IL-12 and IL-23 mRNA expression and secretion in psoriasis.
23327801 Data suggest that expression of RORC (retinoid-related orphan receptor gamma) and interleukin-17 is up-regulated in mononuclear cells cultured with IL23 but only from subjects with Graves disease; this response is independent of thyroid function.
23268293 role in pemphigus vulgaris
23250909 IL-23 affects the proliferation of IL-23 receptor-positive lung cancer cells and that this effect is dependent on the IL-23 concentration.
23121980 A possible involvement of IL-23 in the pathogenesis of polycythemia vera is proposed.
23116756 IL-23A expression is epigenetically regulated through histone post-translational modifications and DNA CpG methylation in non-small cell lung cancer.
23053983 This study investigates gene expression of interleukin (IL)-12-related (IL-12A, IL-12B, IL-23A) cytokine and IL-10 in stimulated monocytes from colorectal cancer (CRC) patients.
23050001 IL-23 could promote HCC metastasis by the upregulation of MMP9 expression via activating NF-kappaB/p65 signaling pathway.
22965992 Human aortic tissue demonstrated a significant increase in IL-23A expression in abdominal aortic aneurysm patients compared with control subjects.
22955875 Il-23A SNPs were not associated with psoriatic arthritis susceptibility in northern Italians.
22909235 Our results might be helpful for explaining the missing heritability of the psoriasis due to epistasis and provide a deep insight into the important role of the IL23/Th17 pathway in the pathogenesis of psoriasis
22851868 IL-17, IL-23 and PIIINP have an inverse correlation with vitamin D in their involvement in the immune response in patients with HCV-4-related liver diseases in Egypt
22759859 relative gene expression of tumour necrosis factor-alpha (TNF-alpha), interferon-gamma (IFN-gamma) and serum levels of interleukin-17 (IL-17) and IL-23 and their association with SLEDAI (SLE disease activity index) score and organ manifestations in pediatric SLE
22705151 The aim of the study was to measure serum and cerebrospinal fluid (CSF) concentration of ICAM-1, IL-21 and IL-23 in patients with tick-borne encephalitis and neuroborreliosis.
22688014 Data show that IL-23 p19 production following IL-1beta stimulation was depended on concurrent NF-kappaB signaling and MAPKs/AP-1 pathways.
22683003 Data show that LPS-induced SIRT1, IL-17, and IL-23 expression and that IL-17 secretion was attenuated by a SIRT1 inhibitor sirtinol pretreatment.
22678234 IL-23 levels were higher in asthmatic than in healthy children (p < 0.001). There was a strong inverse relationship between FEV(1) and IL-23.
22621182 IL-27 was found to be the only IL-12 family member that acts on antigen-presenting cells as a priming signal for IL-23.
22559912 These data demonstrate that IL-23/IL-17 axis, stimulated independently of TGF-beta increase IL-17A gene polymorphism and antiphospholipid antibody production, might contribute to vascular manifestations of primary antiphospholipid syndrome.
22505413 human IL-23 crystal belonged to space group P61 or P65, with unit-cell parameters a = b = 108.94, c = 83.79 A degrees , = 120
22417709 Production of IL-23 was increased in the peripheral mononuclear blood cells of primary Sjogren's syndrome patients compared to controls.
22298331 study found a significant higher systemic IL-23 value in women with breast cancer compared to the control group; patients with shorter overall survival presented higher IL-23 values, suggesting a negative prognostic correlation
22262980 These results demonstrate an involvement of IL-17/-23 system in the early primary Sjogren's syndrome pathogenesis.
22209993 These data gives reason to believe there is an involvement of IL-23 in peripheral arterial disease.
22177788 IL-23, a regulatory element that bridges the innate and adaptive arms of the immune system, might be involved in the inflammatory process observed in fetal abdominal aortic wall.
22174449 A new molecular mechanism for hepatitis B virus-induced IL-23 expression involves activation of the ERK/NF-kappaB pathway by hepatitis B x protein, leading to the transactivation of the IL-23 p19 and p40 promoters.
22144400 Since IL-23 is a maturation and growth factor for IL-17-producing cells, increased IL-23R expression may regulate the function of this putative pathogenic gamma-delta T cell population.
22127978 Patients with SLE display enhanced IL-23p19 expression as a result of hyperactivation of TBK-1, resulting in increased binding of IRF-3 to the promoter.
22003203 IL-23 and IL-1beta are identified as critical factors in the generation of egg antigen-specific transgenic T helper (Th)17 cells involved in the pathogenesis of severe schistosomiasis.
21931205 IL-23 plays an important role in the pathogenesis of ulcerative colitis and is a marker of disease activity in these patients.
21747388 The individual contributions of these cytokines to specific pathologies require investigation and clinical evaluation of the role of IL-12- and IL-23-specific inhibitors.
21740501 Primary immunodeficiencies that impair interleukin-23 (IL-23)-dependent pathways are associated in humans with disseminated non-typhoidal Salmonella bloodstream infections (bacteraemia).
21670317 Systemic IL-23 transgene exposure induces chronic arthritis, severe bone loss and myelopoiesis, which results in increased osteoclast differentiation and systemic bone loss.
21641076 IL-12 and IL-23 were found to be abundantly expressed by macrophages infiltrating papillary and reticular dermis of hidradenitis suppurativa lesional skin
21623003 The IL23A and TNIP1 genes showed convincing evidence for association SNPs mapping to previously reported psoriasis loci show evidence for association to PSA.
21576383 IL-23-responsive innate lymphoid cells are increased in inflammatory bowel disease
21560441 IL-23 and IL-17 participates in the pathogenesis of ulcerative colitis. IL-23 may play a critical role in the development of UC through inducing production of IL-17.
21547355 The IL-23/IL-23R pathway is a potential route to facilitate the malignant progression of cancers.
21531892 Data indicate that Th17 cells convert to Th1 cells through IL-17 induction of mucosal innate IL-12 and IL-23 production.
21518507 The imbalance of T cell subsets in chronic idiopathic thrombocytopenic purpurapatients is mainly associated with IL-12, but not with IL-23 and IL-17.
21516111 Data show that IL-23 induced a positive feedback loop whereby GM-CSF secreted by T(H)17 cells stimulated the production of IL-23 by antigen-presenting cells.
21515794 Data show that deletion of TTP completely abolishes IFN-gamma-mediated p19 mRNA degradation.
21402701 IL-23 induction by beta-glucans is due to activation of c-Rel associated with Ser-10-histone H3 phosphorylation in the il23a promoter mediated by MAPK and SAPK or PKA, and inhibition of il12a transcription
21387004 IL-23 was an essential cytokine in mediating Th17 cell development by IFN-induced dendritic cells.
21302302 This work investigated, for the first time, the role of IL-23 in colorectal cancer resection and chemotherapy, showing no correlation with the severity of disease, tumor removal, and chemotherapeutic treatment.
21231819 IL-17 and IL-23 levels are increased in early as compared to established disease providing evidence that IL-17/IL-23 may play a crucial role in autoimmune diseases.
21227898 Expression of IL-23p19 was increased significantly in inflamed mucosa of crohn Disease.
21161669 Our results indicate increased serum IL-23 levels in ankylosing spondylitis patients
21145111 Human periodontal ligament fibroblasts are a target of Th17, and that IL-17 appears to up-regulate the expression of IL-23 p19 via a homeostatic mechanism involving Akt-, p38 MAPK-, and ERK 1/2-dependent NF-kappaB signalling versus the JNK/AP-1 pathway.
21145044 semiquinone glucoside derivative dose dependent study showed approximately similar level of induction in IL-12p40, IL-12p35, IL-23p19 and RelA proteins expression at all tested concentration (30-90 microg/ml) compared to control
21116820 IL-21 and IL-23 levels are increased in the plasma of spondyloarthritis (SpA) patients compared with healthy volunteers, but not that of IL-17A; no evidence is found that the level of any of these cytokines reflects SpA activity.
20956338 our results identify a critical functional role for IL-23 in psoriasis
20886035 Beta-glucan exposure in the cell wall of fungi is essential for the generation of IL-23 producing dendritic cells and TH-17 immune responses.
20873540 IL-23 may contribute to the chronic inflammation and airway remodelling in allergic rhinitis.
20840651 SAA is a significant inducer of IL-23 and IL-1beta in rheumatoid arthritis (RA) synoviocytes and potentially activates the IL-23/IL-17 pathway in the RA synovium.
20701979 results suggest a possible regulatory role for IL-23 in the menstrual cycle and in early pregnancy, although the extent and function of this role are yet to be determined
20682672 Data show that IL-17 levels are elevated in SLE patients with elevated serum IL-23 in patients with inflammatory manifestations, but lack of correlation between Th17, Th1, and Th2 cytokines suggested independent regulatory mechanisms for these cytokines.
20682175 serum IL-23 levels are significantly elevated in colorectal carcinoma (CRC) vs. control patients and are strongly associated with overexpression of VEGF, thus they may play an important role in carcinogenesis of CRC
20624950 Data indicate dendritic cells from TLR7(-/-) animals showed activated IL-23, and neutralization of IL-17 in the TLR7(-/-) resulted in a significant decrease in the mucogenic response in the lungs.
20603238 Data from a large patient cohort rather suggest that high intra-tumoral expression levels of p35 mRNA and p19 mRNA are associated with a superior clinical outcome.
20428758 IL-23 up-regulates the growth and cell proliferation of oral cancer by promoting the nuclear transactivation of RelA.
20331378 Observational study of gene-disease association. (HuGE Navigator)
20154336 IL23A may have undergone positive selection pressure directed towards conservation, suggesting that functional genetic variants within IL23A will have a significant impact on the host immune response.
20106535 higher expression in peripheral blood lymphocytes and decidua of recurrent spontaneous abortion patients
20071030 CD40-triggering of immature and mature DC but not of primary monocytes induced a rapid expression of high levels of IL-23, free p40, and minor levels of IL-12.
20054003 Data show that that 4-trifluoromethyl-celecoxib can inhibit secretion but not transcription of IL-12 (p35/p40) and IL-23 (p40/p19 heterodimers), and that this is associated with HERP function in the endoplasmic reticulum.
20027291 The IL-23 induced cytokines allow for the subsequent production of IL-12 and amplify the IFN-gamma production in the type-1 cytokine pathway.
19929695 interleukin 17 and interleukin 23 were statistically significantly decreased in tuberculin skin test(TST)-positive individuals, compared with TST-negative individuals
19915944 the concentration of soluble form of vascular endothelial cadherin and IL-23 are raised in sera of patients with Behcet's disease compared with healthy controls
19900478 induces RANKL expression in synoviocytes of rheumatoid arthritis patients via STAT3 and NF-kappaB signal pathways
19845828 In the most severely affected group of Huntington's disease patients there were increased blood levels of IL-23.
19797506 Results desceibe the gene expression of interleukins-17A, -23, and -12 and determine the proximity of IL-17A- and IL-23-producing cells in rheumatoid synovial tissue.
19705136 genes encoding components of the IL23-mediated inflammatory pathway are important determinants of psoriasis pathogenesis across multiple racial groups.
19657406 Levels of IFNgamma, TNFalpha, IL-6, IL-15, IL-18, and IL-23 were increased (above healthy controls) in both affected and unaffected areas from Inflammatory Bowel Diseas.
19605880 these results suggest that the IL-23-induced Th17 pathway is stimulated in inflammatory periodontal lesions
19587005 binding of NKG2D to UL-16 binding protein (ULB)1 contributes to IL-23-dependent IL-17 production by CD4(+) cells in human M. tuberculosis infection.
19542431 Evaluating IL-23 production by dendritic cells (DC) in conjunction with IL-12p70 subunit may be important to elucidate the exact nature of DCs ability to regulate the immune response.
19542049 Synergistic production of IL-23 by dendritic cells derived from cord blood in response to costimulation with LPS and IL-12 is reported.
19479806 IL-23 and IL-17 are up-regulated during acute hepatic rejection after liver transplantation.
19431078 This review summarizes the critical role of the IL-23/IL-17 axis in progressing to chronic destructive arthritis, as well as the dominant cell type in arthritis development and pathology.
19426392 Association of the CagA status of Helicobacter pylori and serum levels of interleukin (IL)-17 and IL-23 in duodenal ulcer patients.
19333939 overexpression of IL-23, but not IL-17, is a pivotal feature of subclinical gut inflammation in ankylosing spondylitis
19322214 The IL-23/Th17 axis has a role in the immunopathogenesis of psoriasis [review]
19264456 Bioactive forms of IL-12 and IL-23 are highly expressed in various DC and macrophage subsets and their marked in situ production suggest that both cytokines have crucial pathogenic role in psoriasis.
19262574 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19247658 IL-23 and IL-17 may play critical roles in the pathogenesis of ankylosing spondylitis and IL-23-stimulated production of IL-17 by PBMCs may be responsible for the development of AS.
19201028 Fibroblast-like synoviocytes are potently regulated by inflammatory cytokines to specifically express IL-23 p19.
19169254 Expanded catalog of genetic loci implicated in psoriasis susceptibility.
19169254 Genome-wide association study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19088061 IL-23 in synergy with IL-18 elicits IFN-gamma production in NK T cells but not in NK cells; upregulates IL-18Ra and CD56 expression
19040306 Significant associations between Arg381Gln SNP and haplotypes encoding this variant were noted in psoriatic arthritis
19034457 Observational study of gene-disease association. (HuGE Navigator)
18825388 The greatest upregulation of IL-23p19, Foxp3 and survivin mRNA was seen in colorectal carcinomas than normal mucosa.
18786233 The role of the IL23/IL17 axis in bronchiolitis obliterans syndrome after lung transplantation is reported.
18754016 Identification of potentially functional splice variants of IL23 receptor (IL-23R) will aid in understanding possible pathogenic mechanisms of IL-23R's contribution to disease susceptibility.
18752933 Serum levels of anti-cyclic citrullinated peptide antibodies and IL-23p19 were higher in psoriatic arthritis patients than in rheumatoid arthritis patients.
18708069 Results describe the crystal structures of the pro-inflammatory cytokine interleukin-23 and its complex with a high-affinity neutralizing antibody.
18680750 Data suggest that the structure of interleukin-23 reveals the molecular basis of p40 subunit sharing with interleukin-12.
18606709 study demonstrates that oxidative stress induced by soluble cigarette smoke components potently inhibits the production of IL-12 and IL-23 by maturing dendritic cells
18579762 Levels of IL-23, IL-17, and IFN-gamma are elevated in Behcet disease(BD) with active uveitis. IL-23/IL-17 pathway together with IFN-gamma is associated with active intraocular inflammation in BD patients.
18497880 intestinal macrophages expressing CD14 contribute to the pathogenesis of Crohn disease via IL-23/IFN-gamma axis
18490716 findings show that lactic acid secreted by tumor cells enhances the transcription of IL-23p19 and IL-23 production in monocytes/macrophages and in tumor-infiltrating immune cells that are stimulated with TLR2 and 4 ligands
18408745 IL-23 stimulates survival and proliferation of Th17 cells and thus serves as a key master cytokine regulator for psoriasis
18373953 The activated IL-23/IL-17 axis is important for the inflammatory immunity in systemic lupus erythematosus.
18319400 NK cells require in vivo priming with IL-12/23 to acquire their full spectrum of functional reactivity, while T cells are dependent upon IL-12/23 signals for the differentiation and/or the maintenance of CD56(+) effector memory T cells
18311793 Immunohistochemical stainings of submandibular glands from C57BL/6.NOD-Aec1Aec2 mice and of salivary gland biopsy specimens from Sjogren's syndrome patients revealed IL-17 and IL-23 staining within lymphocytic foci and epithelial tissues.
18190588 an increased expression of IL-12 p40, IL-12 p35 and IL-23 p19 mRNA was observed in bone marrow mononuclear cells and peripheral blood mononuclear cells of patients with aplastic anemia compared with the corresponding one in normal controls.
18180107 These data indicate that IL23R represents a novel shared susceptibility gene as its association with inflammatory bowel disease (IBD) has recently been verified.
18054783 Data suggest that the p38 MAP kinase and NF-kappaB signaling pathways play an important role in regulation of IL-23p19 expression on human microglia, and are thus potential therapeutic targets in the treatment of MS.
17945537 results here show that IL-23 is elevated in children with malarial anemia, and that IL-10 and IL-12 appear to have important regulatory effects on IL-23 production during childhood malaria
17763202 Upregulated IL-23p19 in synovial fluid may be involved in joint destruction in rheumatoid arthritis.
17606463 Observational study of gene-disease association. (HuGE Navigator)
17564777 mRNA levels of IL23 subunit p19 in active SLE patients was significantly higher compared with those in the inactive SLE patients
17236132 Observational study of gene-disease association. (HuGE Navigator)
17187052 IL-22 is preferentially produced by T(H)17 cells and mediates the acanthosis induced by IL-23
17182554 c-Rel controls IL-23 p19 gene expression through two kappaB sites in the p19 promoter, and propose a c-Rel-dependent enhanceosome model for p19 gene activation.
17021762 Abnormal IL-23 expression may play a role in the pathogenesis and progression of mycosis fungoides to Sezary syndrome.
17007011 This review summarizes information on the expression and role of IL-12 both in patients with Crohn's diease and experimental models of colitis, thus emphasizing differences between IL-12 and IL-23 activity on the development of intestinal inflammation.
16772281 Increased concentrations of p40 subunit of IL-23 in follicles containing oocytes suggest an important role of this cytokine in reproduction.
16751425 An abnormal type-1 T helper (Th1) cell bias exists related to IL-23-expressing dendritic cells from multiple sclerosis (MS) patients, which may play an important role in the pathogenesis of human autoimmune diseases such as MS.
16670765 IL-23 and IL-17 have roles in inflammation [commentary]
16424222 Augmented expression of IL-23 by keratinocytes and cutaneous antigen-presenting cells may contribute to the perpetuation of inflammatory lesions in psoriatic skin.
16339539 IL-23 plays an important role in the FasL-induced IL-17 production.
16300465 This overview provides the historical background and current understanding of the roles of IL-12, IL-23, and T-helper type 1 (TH1) cell development in inflammation and autoimmunity.
15731058 synthesis induced by Bordetella pertussis in monocyte-derived dendritic cells (MDDC)
15583831 IL-23 p19 mRNA is inducible in colonic myofibroblasts by IL-1beta and Tumor Necrosis Factor-alpha
15070757 Macrophages produce neither IL-23 nor IL-12 but predominantly secrete IL-10.
14707118 IL-23 plays a more dominant role than IL-12 in psoriasis, a Th1 type of human inflammatory disease.
12847224 In BALB/c mice, single chain (sc) IL-23-transduced CT26 cells grow progressively until day 26, then the tumors start to regress in most animals; scIL-23 transduction also significantly suppresses lung metastases of CT26 and B16F1 tumor cells.
12162874 Elevated expression of mRNA for IL-23(p19)was found in trigeminal ganglia of BALB/C mice infected with HSV-1 from early acute infection to the beginning of the latent phase.

AA Sequence

MLGSRAVMLLLLLPWTAQGRAVPGGSSPAWTQCQQLSQKLCTLAWSAHPLVGHMDLREEGDEETTNDVPH      1 - 70
IQCGDGCDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSPVGQLHASLLGLSQLLQPEGH     71 - 140
HWETQQIPSLSPSQPWQRLLLRFKILRSLQAFVAVAARVFAHGAATLSP                         141 - 189
//

Text Mined References (218)

PMID Year Title
27053620 2016 [Alterations and clinical implications of interleukin 23 and pepsinogen 1 in the sera and tissues of patients with gastric diseases].
26952371 Consumption of star fruit juice on pro-inflammatory markers and walking distance in the community dwelling elderly.
26657845 2016 Interleukin 23 regulates the functions of human decidual immune cells during early pregnancy.
26656739 2015 Integrating longitudinal serum IL-17 and IL-23 follow-up, along with autoantibodies variation, contributes to predict bullous pemphigoid outcome.
26303210 2015 TLR3 drives IRF6-dependent IL-23p19 expression and p19/EBI3 heterodimer formation in keratinocytes.
26295034 2015 CCL27: Novel Cytokine with Potential Role in Pathogenesis of Multiple Sclerosis.
26151690 2015 New insight to IL-23/IL-17 axis in Iranian infected adult patients with gastritis: effects of genes polymorphisms on expression of cytokines.
26062426 2015 [IL-23 promotes invasion of esophageal squamous cell carcinoma cells by activating DLL4/Notch1 signaling pathway].
25887118 2015 IL-17 and IL-23 in lupus nephritis - association to histopathology and response to treatment.
25877925 2015 Mammalian target of rapamycin complex 2 (mTORC2) regulates LPS-induced expression of IL-12 and IL-23 in human dendritic cells.
25799392 2015 Dysregulated serum IL-23 and SIRT1 activity in peripheral blood mononuclear cells of patients with rheumatoid arthritis.
25793426 2015 IL-17, IL-23, and p73 expression in cutaneous melanoma: a pilot study.
25789703 2015 Association with Genetic Variants in the IL-23 and NF-?B Pathways Discriminates between Mild and Severe Psoriasis Skin Disease.
25769911 2015 Anti-IL-23A mAb BI 655066 for treatment of moderate-to-severe psoriasis: Safety, efficacy, pharmacokinetics, and biomarker results of a single-rising-dose, randomized, double-blind, placebo-controlled trial.
25769808 2015 Increased interleukin 23 (IL23) levels in schizophrenia patients treated with depot antipsychotic medication.
25721268 2015 Interleukin-23 promotes the epithelial-mesenchymal transition of oesophageal carcinoma cells via the Wnt/?-catenin pathway.
25670394 2015 Both interleukin-23A polymorphism and serum interlukin-23 expression are associated with Graves' disease risk.
25649806 2015 Interleukin 23 levels are increased in carotid atherosclerosis: possible role for the interleukin 23/interleukin 17 axis.
25646481 2015 IL-4 abrogates T(H)17 cell-mediated inflammation by selective silencing of IL-23 in antigen-presenting cells.
25639230 2015 Astrocytes facilitate melanoma brain metastasis via secretion of IL-23.
25626905 2015 Inflammasome activation contributes to interleukin-23 production in response to Clostridium difficile.
25621490 2015 The role of IL-23/Th17 pathway in patients with primary immune thrombocytopenia.
25562560 Serum interleukin 17, interleukin 23, and interleukin 10 values in children with atopic eczema/dermatitis syndrome (AEDS): association with clinical severity and phenotype.
25562331 2015 Interleukin-27 and interleukin-23 in patients with systemic lupus erythematosus: possible role in lupus nephritis.
25553835 2015 Clinical significance of serum interleukin-23 and A/G gene (rs17375018) polymorphism in Behçets disease: Relation to neuro-Behçet, uveitis and disease activity.
25525302 2014 Clinical significance of IL-23 regulating IL-17A and/or IL-17F positive Th17 cells in chronic periodontitis.
25439430 2015 Genetic variations of IL17F and IL23A show associations with Behçet's disease and Vogt-Koyanagi-Harada syndrome.
25416956 2014 A proteome-scale map of the human interactome network.
25371211 2015 Non-canonical interleukin 23 receptor complex assembly: p40 protein recruits interleukin 12 receptor ?1 via site II and induces p19/interleukin 23 receptor interaction via site III.
25253467 2014 Tissue specific CD4+ T cell priming determines the requirement for interleukin-23 in experimental arthritis.
25234720 2015 Interleukin 23 produced by myeloid dendritic cells contributes to T-cell dysfunction in HIV type 1 infection by inducing SOCS1 expression.
25083738 2015 IL-23 plasma level measurement in relapsing remitting multiple sclerosis (RRMS) patients compared to healthy subjects.
25046339 2014 IL-19 is a component of the pathogenetic IL-23/IL-17 cascade in psoriasis.
25015728 2014 Investigation of IL-23 (p19, p40) and IL-23R identifies nuclear expression of IL-23 p19 as a favorable prognostic factor in colorectal cancer: a retrospective multicenter study of 675 patients.
24995325 2014 Serum IL-17, IL-23, and TGF-? levels in type 1 and type 2 diabetic patients and age-matched healthy controls.
24990863 2014 Associations between serum interleukin-23 levels and clinical characteristics in patients with systemic lupus erythematosus.
24982422 2014 The unfolded protein response and the phosphorylations of activating transcription factor 2 in the trans-activation of il23a promoter produced by ?-glucans.
24957500 2014 Genetic variation at IL12B, IL23R and IL23A is associated with psoriasis severity, psoriatic arthritis and type 2 diabetes mellitus.
24924839 2014 Interleukin-23 and its correlation with disease activity, joint damage, and functional disability in rheumatoid arthritis.
24910175 2014 Thymic stromal lymphopoietin links keratinocytes and dendritic cell-derived IL-23 in patients with psoriasis.
24909386 2014 The prognostic value of preoperative serum levels of IL-12p40 and IL-23 for survival of patients with colorectal cancer.
24899786 2014 Overexpression of interleukin-23 and interleukin-17 in the lesion of pemphigus vulgaris: a preliminary study.
24796719 2014 IL-27 and IL-12 oppose pro-inflammatory IL-23 in CD4+ T cells by inducing Blimp1.
24781050 2014 Differential effect of vitamin D on NOD2- and TLR-induced cytokines in Crohn's disease.
24643777 2014 The IL-23/Th17 axis is involved in the adaptive immune response to Bacillus anthracis in humans.
24577500 2014 STAT3 activation by KSHV correlates with IL-10, IL-6 and IL-23 release and an autophagic block in dendritic cells.
24568095 2014 Role of IL-23 in the pathogenesis of psoriasis: a novel potential therapeutic target?
24384828 2014 Involvement of IL-23 in enteropathic arthritis patients with inflammatory bowel disease: preliminary results.
24224652 2014 Interleukin-12 (IL-12), but not IL-23, induces the expression of IL-7 in microglia and macrophages: implications for multiple sclerosis.
24144296 2013 Nine loci for ocular axial length identified through genome-wide association studies, including shared loci with refractive error.
24067979 2013 Increased Escherichia coli-induced interleukin-23 production by CD16+ monocytes correlates with systemic immune activation in untreated HIV-1-infected individuals.
24054330 2013 The intracellular sensor NOD2 induces microRNA-29 expression in human dendritic cells to limit IL-23 release.
24040001 2013 Differential expression of IL-17, 22 and 23 in the progression of colorectal cancer in patients with K-ras mutation: Ras signal inhibition and crosstalk with GM-CSF and IFN-?.
23910013 2013 Increased IL-23 and IL-17 expression by peripheral blood cells of patients with primary biliary cirrhosis.
23825942 2013 Hepatitis B virus induces IL-23 production in antigen presenting cells and causes liver damage via the IL-23/IL-17 axis.
23755218 2013 Frailty in old age is associated with decreased interleukin-12/23 production in response to toll-like receptor ligation.
23740229 2014 Evidence that autophagy, but not the unfolded protein response, regulates the expression of IL-23 in the gut of patients with ankylosing spondylitis and subclinical gut inflammation.
23679818 2013 Engagement of CD14 sensitizes primary monocytes to IFN-? to produce IL-12/23p40 and IL-23 through p38 mitogen-activated protein kinase and independent of the janus kinase/signal transducers and activators of transcription signaling.
23673284 2013 Association study in Romanians confirms IL23A gene haplotype block rs2066808/rs11171806 as conferring risk to psoriatic arthritis.
23579029 2013 Protective effect of interleukin-23A (IL23A) haplotype variants on type 1A diabetes mellitus in a Brazilian population.
23563201 2013 The IL23R A/Gln381 allele promotes IL-23 unresponsiveness in human memory T-helper 17 cells and impairs Th17 responses in psoriasis patients.
23520984 2013 Expression of a cytokine, interleukin-23, in experimental periapical lesions.
23489789 2013 Increased interleukin-23 is associated with increased disease activity in patients with rheumatoid arthritis.
23472658 2013 IL-23/IL-17A axis correlates with the nitric oxide pathway in inflammatory bowel disease: immunomodulatory effect of retinoic acid.
23425136 2013 Normal inflammasome activation and low production of IL-23 by monocyte-derived macrophages from subjects with a history of reactive arthritis.
23393581 2013 Potentially functional polymorphism in IL-23 receptor and risk of acute myeloid leukemia in a Chinese population.
23388728 2013 Differential regulation of interleukin-12 (IL-12)/IL-23 by Tim-3 drives T(H)17 cell development during hepatitis C virus infection.
23376980 2013 Susceptibility-associated genetic variation at IL12B enhances Th1 polarization in psoriasis.
23327801 2013 The role of the IL-23/IL-17 axis in the pathogenesis of Graves' disease.
23268293 2012 Elevated levels of interleukin-23 in sera of patients with pemphigus vulgaris.
23250909 2013 Interleukin 23 regulates proliferation of lung cancer cells in a concentration-dependent way in association with the interleukin-23 receptor.
23121980 Evaluation of interleukin-23 plasma levels in patients with polycythemia vera and essential thrombocythemia.
23116756 2013 IL-23 is pro-proliferative, epigenetically regulated and modulated by chemotherapy in non-small cell lung cancer.
23053983 2012 Monocytes expression of IL-12 related and IL-10 genes in association with development of colorectal cancer.
23050001 2012 Interleukin 23 promotes hepatocellular carcinoma metastasis via NF-kappa B induced matrix metalloproteinase 9 expression.
22965992 2012 Experimental abdominal aortic aneurysm formation is mediated by IL-17 and attenuated by mesenchymal stem cell treatment.
22955875 2013 IL-23A, IL-23R, IL-17A and IL-17R polymorphisms in different psoriatic arthritis clinical manifestations in the northern Italian population.
22909235 2013 Gene-gene interactions in IL23/Th17 pathway contribute to psoriasis susceptibility in Chinese Han population.
22851868 2012 Vitamin D deficiency: correlation to interleukin-17, interleukin-23 and PIIINP in hepatitis C virus genotype 4.
22759859 2012 Gene expression of cytokines (TNF-?, IFN-?), serum profiles of IL-17 and IL-23 in paediatric systemic lupus erythematosus.
22705151 2012 ssICAM-1, IL-21 and IL-23 in patients with tick borne encephalitis and neuroborreliosis.
22688014 2012 Up-regulation of IL-23 p19 expression in human periodontal ligament fibroblasts by IL-1? via concurrent activation of the NF-?B and MAPKs/AP-1 pathways.
22683003 2012 Porphyromonas gingivalis lipopolysaccharide regulates interleukin (IL)-17 and IL-23 expression via SIRT1 modulation in human periodontal ligament cells.
22678234 2012 Serum IL-23 strongly and inversely correlates with FEV1 in asthmatic children.
22621182 2012 IL-27 acts as a priming signal for IL-23 but not IL-12 production on human antigen-presenting cells.
22559912 2013 Increased activity of interleukin-23/interleukin-17 cytokine axis in primary antiphospholipid syndrome.
22505413 2012 Preparation, crystallization and preliminary X-ray diffraction studies of the glycosylated form of human interleukin-23.
22417709 2012 TLR2 ligation induces the production of IL-23/IL-17 via IL-6, STAT3 and NF-kB pathway in patients with primary Sjogren's syndrome.
22298331 2012 Clinical significance of circulating interleukin-23 as a prognostic factor in breast cancer patients.
22262980 2012 Expression of IL-17, IL-23 and their receptors in minor salivary glands of patients with primary Sjögren's syndrome.
22209993 2012 Interleukin-23 serum levels in patients affected by peripheral arterial disease.
22177788 2012 IL-1? and IL-23 in amniotic fluids of ultrasound-detected aortic intima/media thickness and growth retardation.
22174449 2012 Upregulation of IL-23 expression in patients with chronic hepatitis B is mediated by the HBx/ERK/NF-?B pathway.
22144400 2012 Enrichment of circulating interleukin-17-secreting interleukin-23 receptor-positive ?/? T cells in patients with active ankylosing spondylitis.
22127978 2012 Enhanced interferon regulatory factor 3 binding to the interleukin-23p19 promoter correlates with enhanced interleukin-23 expression in systemic lupus erythematosus.
22003203 2011 The pathogenic Th17 cell response to major schistosome egg antigen is sequentially dependent on IL-23 and IL-1?.
21931205 2011 Serum interleukin-23 levels in patients with ulcerative colitis.
21747388 2011 Therapeutic targeting of the IL-12/23 pathways: generation and characterization of ustekinumab.
21740501 2011 The IL-23 axis in Salmonella gastroenteritis.
21670317 2011 IL-23 is critical for induction of arthritis, osteoclast formation, and maintenance of bone mass.
21641076 2011 Expression of the IL-23/Th17 pathway in lesions of hidradenitis suppurativa.
21623003 2011 Confirmation of TNIP1 and IL23A as susceptibility loci for psoriatic arthritis.
21576383 2011 IL-23-responsive innate lymphoid cells are increased in inflammatory bowel disease.
21560441 2011 Serum contents of IL-23 and IL-17 in the patients with ulcerative colitis and the clinical significance.
21547355 2011 IL-23/IL-23R: potential mediator of intestinal tumor progression from adenomatous polyps to colorectal carcinoma.
21531892 2011 Th17 cells induce colitis and promote Th1 cell responses through IL-17 induction of innate IL-12 and IL-23 production.
21518507 2011 [Expression and significance of interleukin-23 and its related cytokines in chronic idiopathic thrombocytopenic purpura].
21516111 2011 The encephalitogenicity of T(H)17 cells is dependent on IL-1- and IL-23-induced production of the cytokine GM-CSF.
21515794 2011 Posttranscriptional regulation of IL-23 expression by IFN-gamma through tristetraprolin.
21402701 2011 Notch- and transducin-like enhancer of split (TLE)-dependent histone deacetylation explain interleukin 12 (IL-12) p70 inhibition by zymosan.
21387004 2011 Interferon-?-conditioned human monocytes combine a Th1-orienting attitude with the induction of autologous Th17 responses: role of IL-23 and IL-12.
21302302 2011 Role of interleukin-23 circulating levels increase in resected colorectal cancer before and after chemotherapy: preliminary data and future perspectives.
21231819 2011 Interleukin-17 and interleukin-23 in patients with polymyositis and dermatomyositis.
21227898 2011 The increased expression of IL-23 in inflammatory bowel disease promotes intraepithelial and lamina propria lymphocyte inflammatory responses and cytotoxicity.
21161669 2011 Increased serum IL-17 and IL-23 in the patient with ankylosing spondylitis.
21145111 2011 IL-17R activation of human periodontal ligament fibroblasts induces IL-23 p19 production: Differential involvement of NF-?B versus JNK/AP-1 pathways.
21145044 2011 Induction of immunostimulatory cytokine genes expression in human PBMCs by a novel semiquinone glucoside derivative (SQGD) isolated from a Bacillus sp. INM-1.
21116820 2012 Increased plasma levels of IL-21 and IL-23 in spondyloarthritis are not associated with clinical and MRI findings.
20956338 2010 Cutting edge: A critical functional role for IL-23 in psoriasis.
20953190 2010 A genome-wide association study identifies new psoriasis susceptibility loci and an interaction between HLA-C and ERAP1.
20886035 2010 Generation of IL-23 producing dendritic cells (DCs) by airborne fungi regulates fungal pathogenicity via the induction of T(H)-17 responses.
20873540 2010 [The expression of IL-23 in nasal mucosa of allergic rhinitis patients and its significance].
20840651 2010 Induction of interleukin-23 p19 by serum amyloid A (SAA) in rheumatoid synoviocytes.
20701979 2010 Expression and role of interleukin-23 in human endometrium throughout the menstrual cycle and early pregnancy.
20682672 2010 The relation of interleukin 17 (IL-17) and IL-23 to Th1/Th2 cytokines and disease activity in systemic lupus erythematosus.
20682175 2010 Elevated serum level of IL-23 correlates with expression of VEGF in human colorectal carcinoma.
20624950 2010 Respiratory virus-induced TLR7 activation controls IL-17-associated increased mucus via IL-23 regulation.
20603238 2010 High IL-12 p35 and IL-23 p19 mRNA expression is associated with superior outcome in ovarian cancer.
20428758 2010 IL-23 promotes growth and proliferation in human squamous cell carcinoma of the oral cavity.
20331378 2010 Large-scale candidate gene analysis of spontaneous clearance of hepatitis C virus.
20154336 2010 Comprehensive sequence analysis of the human IL23A gene defines new variation content and high rate of evolutionary conservation.
20106535 2010 Increased prevalence of T helper 17 (Th17) cells in peripheral blood and decidua in unexplained recurrent spontaneous abortion patients.
20071030 2010 CD40 ligand-triggered human dendritic cells mount interleukin-23 responses that are further enhanced by danger signals.
20054003 2010 Inhibition of secretion of interleukin (IL)-12/IL-23 family cytokines by 4-trifluoromethyl-celecoxib is coupled to degradation via the endoplasmic reticulum stress protein HERP.
20027291 2009 Salmonella induced IL-23 and IL-1beta allow for IL-12 production by monocytes and Mphi1 through induction of IFN-gamma in CD56 NK/NK-like T cells.
19929695 2010 Regulatory T cells modulate Th17 responses in patients with positive tuberculin skin test results.
19915944 2010 Raised concentration of soluble form of vascular endothelial cadherin and IL-23 in sera of patients with Behçet's disease.
19900478 2010 IL-23 induces receptor activator of NF-kappaB ligand expression in fibroblast-like synoviocytes via STAT3 and NF-kappaB signal pathways.
19845828 2010 Blood levels of kynurenines, interleukin-23 and soluble human leucocyte antigen-G at different stages of Huntington's disease.
19797506 2009 Monocyte derived interleukin (IL)-23 is an important determinant of synovial IL-17A expression in rheumatoid arthritis.
19705136 2010 Genetic evidence for involvement of the IL23 pathway in Thai psoriatics.
19657406 2009 High levels of proinflammatory cytokines, but not markers of tissue injury, in unaffected intestinal areas from patients with IBD.
19605880 2009 The involvement of IL-23 and the Th17 pathway in periodontitis.
19587005 2009 NKG2D-dependent IL-17 production by human T cells in response to an intracellular pathogen.
19542431 2009 Cytokine-dependent modification of IL-12p70 and IL-23 balance in dendritic cells by ligand activation of Valpha24 invariant NKT cells.
19542049 2009 Synergistic production of interleukin-23 by dendritic cells derived from cord blood in response to costimulation with LPS and IL-12.
19479806 2009 Changes in the serum levels of interleukin-17/interleukin-23 during acute rejection in liver transplantation.
19431078 2009 The IL-12/IL-23 axis and its role in Th17 cell development, pathology and plasticity in arthritis.
19426392 2009 Association of the CagA status of Helicobacter pylori and serum levels of interleukin (IL)-17 and IL-23 in duodenal ulcer patients.
19333939 2009 Overexpression of interleukin-23, but not interleukin-17, as an immunologic signature of subclinical intestinal inflammation in ankylosing spondylitis.
19322214 2009 The IL-23/Th17 axis in the immunopathogenesis of psoriasis.
19264456 2009 Increased expression of IL-12p70 and IL-23 by multiple dendritic cell and macrophage subsets in plaque psoriasis.
19262574 2009 Genome-wide association scan yields new insights into the immunopathogenesis of psoriasis.
19247658 2009 Expression of IL-23 and IL-17 and effect of IL-23 on IL-17 production in ankylosing spondylitis.
19201028 2009 Synergism between tumor necrosis factor alpha and interleukin-17 to induce IL-23 p19 expression in fibroblast-like synoviocytes.
19169254 2009 Genome-wide scan reveals association of psoriasis with IL-23 and NF-kappaB pathways.
19088061 2009 IL-23 modulates CD56+/CD3- NK cell and CD56+/CD3+ NK-like T cell function differentially from IL-12.
19040306 2009 Association of interleukin 23 receptor variants with psoriatic arthritis.
19034457 2009 Lack of association between interleukin 23 receptor gene polymorphisms and rheumatoid arthritis susceptibility.
18825388 2009 High expression of Foxp3, IL-23p19 and survivin mRNA in colorectal carcinoma.
18786233 2008 The role of the IL23/IL17 axis in bronchiolitis obliterans syndrome after lung transplantation.
18754016 2008 Identification and characterization of multiple splice forms of the human interleukin-23 receptor alpha chain in mitogen-activated leukocytes.
18752933 2009 Anti-cyclic citrullinated peptide antibodies and IL-23p19 in psoriatic arthritis.
18708069 2008 Crystal structures of the pro-inflammatory cytokine interleukin-23 and its complex with a high-affinity neutralizing antibody.
18680750 2008 The structure of interleukin-23 reveals the molecular basis of p40 subunit sharing with interleukin-12.
18675459 2008 IL-23 and IL-12 responses in activated human T cells retrovirally transduced with IL-23 receptor variants.
18606709 2008 Cigarette smoke-induced oxidative stress suppresses generation of dendritic cell IL-12 and IL-23 through ERK-dependent pathways.
18579762 2008 Upregulated IL-23 and IL-17 in Behçet patients with active uveitis.
18497880 2008 Unique CD14 intestinal macrophages contribute to the pathogenesis of Crohn disease via IL-23/IFN-gamma axis.
18490716 2008 Tumor-secreted lactic acid promotes IL-23/IL-17 proinflammatory pathway.
18408745 2008 T-helper 17 cells in psoriatic plaques and additional genetic links between IL-23 and psoriasis.
18373953 2008 Hyperproduction of IL-23 and IL-17 in patients with systemic lupus erythematosus: implications for Th17-mediated inflammation in auto-immunity.
18319400 2008 A role for interleukin-12/23 in the maturation of human natural killer and CD56+ T cells in vivo.
18311793 2008 Salivary gland tissue expression of interleukin-23 and interleukin-17 in Sjögren's syndrome: findings in humans and mice.
18190588 2009 Elevated expression of IL-12 and IL-23 in patients with aplastic anemia.
18180107 2008 3'UTR C2370A allele of the IL-23 receptor gene is associated with relapsing-remitting multiple sclerosis.
18054783 2008 Inducible IL-23p19 expression in human microglia via p38 MAPK and NF-kappaB signal pathways.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17945537 2008 Increased circulating interleukin (IL)-23 in children with malarial anemia: in vivo and in vitro relationship with co-regulatory cytokines IL-12 and IL-10.
17888176 2007 IL-23 induces human osteoclastogenesis via IL-17 in vitro, and anti-IL-23 antibody attenuates collagen-induced arthritis in rats.
17763202 The clinical role of IL-23p19 in patients with rheumatoid arthritis.
17606463 2008 Functional variants of interleukin-23 receptor gene confer risk for rheumatoid arthritis but not for systemic sclerosis.
17564777 2007 Dysregulated expression of interleukin-23 and interleukin-12 subunits in systemic lupus erythematosus patients.
17236132 2007 A large-scale genetic association study confirms IL12B and leads to the identification of IL23R as psoriasis-risk genes.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
17187052 2007 Interleukin-22, a T(H)17 cytokine, mediates IL-23-induced dermal inflammation and acanthosis.
17182554 2007 Essential roles of c-Rel in TLR-induced IL-23 p19 gene expression in dendritic cells.
17021762 2006 Abnormal expression of interleukin-23 in mycosis fungoides/Sézary syndrome lesions.
17007011 2006 Interleukin-12 and Th1 immune response in Crohn's disease: pathogenetic relevance and therapeutic implication.
16772281 2006 Ovarian follicular concentration of IL-12, IL-15, IL-18 and p40 subunit of IL-12 and IL-23.
16751425 2006 IL-23 is increased in dendritic cells in multiple sclerosis and down-regulation of IL-23 by antisense oligos increases dendritic cell IL-10 production.
16688182 2006 IL-23 promotes tumour incidence and growth.
16670765 2006 The IL-23/IL-17 axis in inflammation.
16482511 2006 Divergent effects of IL-12 and IL-23 on the production of IL-17 by human T cells.
16424222 2006 In vitro and in situ expression of IL-23 by keratinocytes in healthy skin and psoriasis lesions: enhanced expression in psoriatic skin.
16342235 2006 Preferential production of the IL-12(p40)/IL-23(p19) heterodimer by dendritic cells from human newborns.
16341674 2005 Transcriptome analysis of human gastric cancer.
16339539 2005 Fas ligand induces cell-autonomous IL-23 production in dendritic cells, a mechanism for Fas ligand-induced IL-17 production.
16300465 2005 IL-23: changing the verdict on IL-12 function in inflammation and autoimmunity.
15731058 2005 Bordetella pertussis-infected human monocyte-derived dendritic cells undergo maturation and induce Th1 polarization and interleukin-23 expression.
15583831 2005 Interleukin-1beta and tumor necrosis factor-alpha upregulate interleukin-23 subunit p19 gene expression in human colonic subepithelial myofibroblasts.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15486065 2005 Extracellular nucleotide signaling by P2 receptors inhibits IL-12 and enhances IL-23 expression in human dendritic cells: a novel role for the cAMP pathway.
15265908 2004 ICOS expression by activated human Th cells is enhanced by IL-12 and IL-23: increased ICOS expression enhances the effector function of both Th1 and Th2 cells.
15114670 2004 Commensal Gram-negative bacteria prime human dendritic cells for enhanced IL-23 and IL-27 expression and enhanced Th1 development.
15070757 2004 Human IL-23-producing type 1 macrophages promote but IL-10-producing type 2 macrophages subvert immunity to (myco)bacteria.
14707118 2004 Increased expression of interleukin 23 p19 and p40 in lesional skin of patients with psoriasis vulgaris.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12847224 2003 Antitumor and antimetastatic activity of IL-23.
12671732 2003 Genetic variations in the interleukin-12/interleukin-23 receptor (beta1) chain, and implications for IL-12 and IL-23 receptor structure and function.
12525561 2003 A unique role for IL-23 in promoting cellular immunity.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12421946 2002 Regulation of virus-induced IL-12 and IL-23 expression in human macrophages.
12162874 2002 Herpes simplex virus type 1 infection induces upregulation of interleukin-23 (p19) mRNA expression in trigeminal ganglia of BALB/c mice.
12023369 2002 A receptor for the heterodimeric cytokine IL-23 is composed of IL-12Rbeta1 and a novel cytokine receptor subunit, IL-23R.
11390512 2001 Ubiquitous transgenic expression of the IL-23 subunit p19 induces multiorgan inflammation, runting, infertility, and premature death.
11114383 2000 Novel p19 protein engages IL-12p40 to form a cytokine, IL-23, with biological activities similar as well as distinct from IL-12.
8570611 1996 Analysis of differential gene expression by display of 3' end restriction fragments of cDNAs.