Property Summary

Ligand Count 2
NCBI Gene PubMed Count 245
PubMed Score 158.20
PubTator Score 904.09

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (5)

Disease log2 FC p
psoriasis 2.000 1.2e-54
diabetes mellitus 1.100 1.8e-03
lung cancer 2.000 1.1e-04
spina bifida -1.669 3.6e-02
tuberculosis -1.100 2.4e-04

Protein-protein Interaction (3)

Gene RIF (223)

AA Sequence

MLGSRAVMLLLLLPWTAQGRAVPGGSSPAWTQCQQLSQKLCTLAWSAHPLVGHMDLREEGDEETTNDVPH      1 - 70
IQCGDGCDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSPVGQLHASLLGLSQLLQPEGH     71 - 140
HWETQQIPSLSPSQPWQRLLLRFKILRSLQAFVAVAARVFAHGAATLSP                         141 - 189
//

Text Mined References (245)

PMID Year Title