Property Summary

NCBI Gene PubMed Count 65
PubMed Score 49.73
PubTator Score 52.16

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
glioblastoma 2.200 1.8e-06
tuberculosis -1.800 4.0e-03
pancreatic ductal adenocarcinoma liver m... -1.349 4.4e-03
non-small cell lung cancer 1.088 2.2e-09
intraductal papillary-mucinous neoplasm ... 1.600 3.2e-04
lung cancer -2.200 3.8e-05
pancreatic cancer 1.600 1.1e-04
adult high grade glioma 2.100 8.6e-06
pilocytic astrocytoma 3.500 2.4e-13
lung carcinoma -2.400 9.3e-26
spina bifida -1.085 4.3e-02
ovarian cancer 1.200 1.4e-02

Gene RIF (37)

PMID Text
26268530 The findings of this study support IL1RAP as a novel potential Alzheimer's disease target and highlight the use of amyloid PET as a valuable Alzheimer's disease endophenotype, particularly in a longitudinal framework.
25517029 The SNP rs4624606 in IL-1RAcP was nominally associated with CAD risk.
24935223 Data suggest serum levels of soluble IL1RAP (from alternative splicing) are down-regulated in endometriosis throughout menstrual cycle; IL1RAP levels (which peak in proliferative phase in fertile women) exhibit minor variations in endometriosis.
24915116 Plasma sIL1RAP levels are reduced in obesity and can potentially act as biomarkers of obesity.
23980170 Combined crystallography and small-angle X-ray-scattering studies reveal that ST2 possesses hinge flexibility between the D3 domain and D1D2 module, whereas IL-1RAcP exhibits a rigid conformation in the unbound state in solution.
22904187 MARCH8-mediated polyubiquitination and degradation of IL1RAP is an important mechanism for negative regulation of IL-1beta-induced signaling pathways.
22778412 Interleukin-1R3 mediates interleukin-1-induced potassium current increase through fast activation of Akt kinase.
22723552 Knockdown of IL1RAP decreased clonogenicity and increased cell death of AML cells.
22251538 The genetic polymorphisms of IL-1ss-2023 C allele, IL- 1RAcP -8261 T allele and -8183 A allele are probable host factors for persistent HBV infection.
21958553 decreased protein levels in the peritoneal fluid of women with endometriosis
21373837 Studies indicate that new targets have recently been investigated as potential modulators in myeloid leukemia pathogenesis, including miR-328, BMI1, FOXOs and IL1RAP.
21272866 This study showed a significant downregulation of soluble interleukin-1 receptor accessory protein expression in the endometrium of women with endometriosis.
20805474 identifies IL1RAP as a unique cell surface biomarker distinguishing Ph(+) from Ph(-) candidate chronic myeloid leukemia (CML) stem cells and opens up a previously unexplored avenue for therapy of CML
20730440 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
20140262 Observational study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19527514 Observational study of gene-disease association. (HuGE Navigator)
19481478 an isoform of the IL-1 receptor accessory protein (termed AcPb) was identified that is expressed exclusively in the CNS.
19240061 Observational study of gene-disease association. (HuGE Navigator)
19019335 Observational study of gene-disease association. (HuGE Navigator)
18818748 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18299313 IL-1ra is associated with preserved beta-cell capacity in type 1 diabetes.
18156980 Observational study of gene-disease association. (HuGE Navigator)
17949817 IL-1RAcP687 functions in the IL-1 signal transduction and response. Furthermore, IL-1RAcP687 can associate with proteins involved in the upstream IL-1 signaling pathway such as IL-1RI, Tollip, and MyD88.
17889143 Observational study of gene-disease association. (HuGE Navigator)
17507369 IL-1RAcP, MyD88, and IRAK-4 are the stable components of the endogenous type I interleukin-1 (IL-1) receptor signaling complex
16519819 Observational study of gene-disease association. (HuGE Navigator)
15849357 Analysis of a three-dimensional docking model of the TIR-TIR interaction between MyD88 and IL1RAcP
15528363 Specific destabilization of membrane-bound IL-1 receptor accessory protein mRNA in HepG2 hepatoma cells is mediated by its 2.8-kilobase 3'-untranslated region.
14734551 IL-1F6, IL-1F8, and IL-1F9 signal through IL-1Rrp2 and IL-1RAcP in Jurkat cells
12781872 The dramatic changes in levels of IL-1RAcP mRNAs suggest important functions in regulating sensitivity to IL-1 during stress and may play a role in oncogenic processes that are engaged during chronic inflammation.
12530978 soluble form of IL-1R AcP contributes to the antagonism of IL-1 action by the type II decoy receptor
12393699 Observational study of gene-disease association. (HuGE Navigator)
11880380 Identification of essential regions in the cytoplasmic tail of interleukin-1 receptor accessory protein critical for interleukin-1 signaling

AA Sequence

MTLLWCVVSLYFYGILQSDASERCDDWGLDTMRQIQVFEDEPARIKCPLFEHFLKFNYSTAHSAGLTLIW      1 - 70
YWTRQDRDLEEPINFRLPENRISKEKDVLWFRPTLLNDTGNYTCMLRNTTYCSKVAFPLEVVQKDSCFNS     71 - 140
PMKLPVHKLYIEYGIQRITCPNVDGYFPSSVKPTITWYMGCYKIQNFNNVIPEGMNLSFLIALISNNGNY    141 - 210
TCVVTYPENGRTFHLTRTLTVKVVGSPKNAVPPVIHSPNDHVVYEKEPGEELLIPCTVYFSFLMDSRNEV    211 - 280
WWTIDGKKPDDITIDVTINESISHSRTEDETRTQILSIKKVTSEDLKRSYVCHARSAKGEVAKAAKVKQK    281 - 350
VPAPRYTVELACGFGATVLLVVILIVVYHVYWLEMVLFYRAHFGTDETILDGKEYDIYVSYARNAEEEEF    351 - 420
VLLTLRGVLENEFGYKLCIFDRDSLPGGIVTDETLSFIQKSRRLLVVLSPNYVLQGTQALLELKAGLENM    421 - 490
ASRGNINVILVQYKAVKETKVKELKRAKTVLTVIKWKGEKSKYPQGRFWKQLQVAMPVKKSPRRSSSDEQ    491 - 560
GLSYSSLKNV                                                                561 - 570
//

Text Mined References (75)

PMID Year Title
26268530 2015 GWAS of longitudinal amyloid accumulation on 18F-florbetapir PET in Alzheimer's disease implicates microglial activation gene IL1RAP.
25595648 2015 Increased IL-33 expression in chronic obstructive pulmonary disease.
25517029 2014 Associations between variants in IL-33/ST2 signaling pathway genes and coronary heart disease risk.
24935223 2014 Blood soluble interleukin 1 receptor accessory protein levels are consistently low throughout the menstrual cycle of women with endometriosis.
24915116 2014 Plasma levels of soluble interleukin 1 receptor accessory protein are reduced in obesity.
23980170 2013 Structural insights into the interaction of IL-33 with its receptors.
23479569 2013 Selective killing of candidate AML stem cells by antibody targeting of IL1RAP.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22904187 2012 The E3 ubiquitin ligase MARCH8 negatively regulates IL-1?-induced NF-?B activation by targeting the IL1RAP coreceptor for ubiquitination and degradation.
22778412 2012 Interleukin-1R3 mediates interleukin-1-induced potassium current increase through fast activation of Akt kinase.
22723552 2012 Overexpression of IL-1 receptor accessory protein in stem and progenitor cells and outcome correlation in AML and MDS.
22251538 Interleukin-1ß and interleukin-1 receptor accessory protein gene polymorphisms are associated with persistent hepatitis B virus infection.
21958553 2011 Decreased concentrations of soluble interleukin-1 receptor accessory protein levels in the peritoneal fluid of women with endometriosis.
21373837 2011 In search of CML stem cells' deadly weakness.
21272866 2011 Distinct expression of the soluble and the membrane-bound forms of interleukin-1 receptor accessory protein in the endometrium of women with endometriosis.
20966902 2011 Genome-wide association study of anthropometric traits and evidence of interactions with age and study year in Filipino women.
20805474 2010 Isolation and killing of candidate chronic myeloid leukemia stem cells by antibody targeting of IL-1 receptor accessory protein.
20802483 2010 Structural insights into the assembly and activation of IL-1? with its receptors.
20730440 2011 Genetic factors responsible for long bone fractures non-union.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20140262 2010 Maternal and fetal genetic associations of PTGER3 and PON1 with preterm birth.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19946888 2010 Defining the membrane proteome of NK cells.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19836339 2009 Structure of IL-33 and its interaction with the ST2 and IL-1RAcP receptors--insight into heterotrimeric IL-1 signaling complexes.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19527514 2009 Racial disparity in pathophysiologic pathways of preterm birth based on genetic variants.
19481478 2009 A central nervous system-restricted isoform of the interleukin-1 receptor accessory protein modulates neuronal responses to interleukin-1.
19369195 2009 Large-scale proteomics analysis of the human kinome.
19240061 2009 Coeliac disease-associated risk variants in TNFAIP3 and REL implicate altered NF-kappaB signalling.
19019335 2009 Spontaneous preterm birth in African Americans is associated with infection and inflammatory response gene variants.
18818748 2008 Preterm birth in Caucasians is associated with coagulation and inflammation pathway gene variants.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18385676 2008 Genome-wide association scan of tag SNPs identifies a susceptibility locus for lung cancer at 15q25.1.
18299313 2008 Association of IL-1ra and adiponectin with C-peptide and remission in patients with type 1 diabetes.
18156980 2008 Fetal polymorphisms in anti-inflammatory cytokine and beta-adrenergic receptor genes associated with placental pathological lesions.
17949817 2008 A novel alternatively spliced interleukin-1 receptor accessory protein mIL-1RAcP687.
17889143 2007 Cytokine polymorphisms and risk of infection after kidney transplantation.
17507369 2007 Mass spectrometric analysis of the endogenous type I interleukin-1 (IL-1) receptor signaling complex formed after IL-1 binding identifies IL-1RAcP, MyD88, and IRAK-4 as the stable components.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
16519819 2006 Analysis of polymorphisms in 16 genes in type 1 diabetes that have been associated with other immune-mediated diseases.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16341674 2005 Transcriptome analysis of human gastric cancer.
15849357 2005 Interactive sites in the MyD88 Toll/interleukin (IL) 1 receptor domain responsible for coupling to the IL1beta signaling pathway.
15528363 2004 The 3' untranslated region of the membrane-bound IL-1R accessory protein mRNA confers tissue-specific destabilization.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15231748 2004 Functional proteomics mapping of a human signaling pathway.
14734551 2004 Interleukin (IL)-1F6, IL-1F8, and IL-1F9 signal through IL-1Rrp2 and IL-1RAcP to activate the pathway leading to NF-kappaB and MAPKs.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12781872 2003 Expression of alternatively spliced interleukin-1 receptor accessory protein mRNAs is differentially regulated during inflammation and apoptosis.
12721283 2003 TIRP, a novel Toll/interleukin-1 receptor (TIR) domain-containing adapter protein involved in TIR signaling.
12659850 2003 Characterization of a cascade of protein interactions initiated at the IL-1 receptor.
12530978 2003 The soluble form of IL-1 receptor accessory protein enhances the ability of soluble type II IL-1 receptor to inhibit IL-1 action.
12483539 2002 A role for SHPS-1/SIRPalpha1 in IL-1beta- and TNFalpha-dependent signaling.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12393699 2002 Host defense and inflammatory gene polymorphisms are associated with outcomes after HLA-identical sibling bone marrow transplantation.
11880380 2002 Identification of essential regions in the cytoplasmic tail of interleukin-1 receptor accessory protein critical for interleukin-1 signaling.
11416133 2001 Transactivation by the p65 subunit of NF-kappaB in response to interleukin-1 (IL-1) involves MyD88, IL-1 receptor-associated kinase 1, TRAF-6, and Rac1.
11279295 2001 Interleukin-1 receptor accessory protein is constitutively expressed in human endometrium throughout the menstrual cycle.
10854325 2000 Tollip, a new component of the IL-1RI pathway, links IRAK to the IL-1 receptor.
10799889 2000 IL-1 signaling cascade in liver cells and the involvement of a soluble form of the IL-1 receptor accessory protein.
10373529 1999 Activation of phosphatidylinositol 3-kinase in response to interleukin-1 leads to phosphorylation and activation of the NF-kappaB p65/RelA subunit.
9923604 1999 Interleukin-1beta activates a short STAT-3 isoform in clonal insulin-secreting cells.
9862719 1998 The type II IL-1 receptor interacts with the IL-1 receptor accessory protein: a novel mechanism of regulation of IL-1 responsiveness.
9820540 1998 IL-1 receptor accessory protein is an essential component of the IL-1 receptor.
9479509 1998 The human gene encoding the interleukin-1 receptor accessory protein (IL1RAP) maps to chromosome 3q28 by fluorescence in situ hybridization and radiation hybrid mapping.
9371760 1997 Recruitment of IRAK to the interleukin 1 receptor complex requires interleukin 1 receptor accessory protein.
9065432 1997 The interleukin-1 receptor accessory protein (IL-1RAcP) is essential for IL-1-induced activation of interleukin-1 receptor-associated kinase (IRAK) and stress-activated protein kinases (SAP kinases).
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8837778 1996 TRAF6 is a signal transducer for interleukin-1.
8626725 1996 IL-1Rrp is a novel receptor-like molecule similar to the type I interleukin-1 receptor and its homologues T1/ST2 and IL-1R AcP.
7775431 1995 Molecular cloning and characterization of a second subunit of the interleukin 1 receptor complex.