Property Summary

NCBI Gene PubMed Count 18
PubMed Score 14.90
PubTator Score 33.40

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
inflammatory breast cancer 286 7.5e-08

Expression

  Differential Expression (1)

Disease log2 FC p
inflammatory breast cancer -3.500 7.5e-08

Gene RIF (12)

AA Sequence

MDWPHNLLFLLTISIFLGLGQPRSPKSKRKGQGRPGPLAPGPHQVPLDLVSRMKPYARMEEYERNIEEMV      1 - 70
AQLRNSSELAQRKCEVNLQLWMSNKRSLSPWGYSINHDPSRIPVDLPEARCLCLGCVNPFTMQEDRSMVS     71 - 140
VPVFSQVPVRRRLCPPPPRTGPCRQRAVMETIAVGCTCIF                                  141 - 180
//

Text Mined References (18)

PMID Year Title