Property Summary

NCBI Gene PubMed Count 54
PubMed Score 54.98
PubTator Score 53.81

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
gastric cancer 1.400 1.2e-03
osteosarcoma -1.925 1.4e-04
lung cancer -1.800 1.7e-04
interstitial cystitis 2.100 3.4e-03
primary Sjogren syndrome 1.300 2.5e-03
lung carcinoma -1.400 2.5e-13
ductal carcinoma in situ 1.400 2.8e-02
invasive ductal carcinoma 1.800 2.3e-02
ulcerative colitis 1.300 2.6e-03
psoriasis 1.600 4.9e-62

Protein-protein Interaction (4)

Gene RIF (31)

PMID Text
27080863 Our data indicate a possible regulatory role for the multiple sclerosis-associated IKZF3 and IQGAP1 variants.
26546109 results indicate that overexpression of Aiolos may contribute to pathogenesis of SLE and RA
26185311 identified a unique case of adult acute B-cell lymphoblastic leukemia with masked low hypodiploidy (mLH) by genomic duplication
25620289 The allele T of rs10852936 surrounding the IKZF3-ZPBP2 locus confers risk for early-onset psoriasis.
25608224 Aiolos improved the survival of Nalm6 cells via PTEN and Aktdependent processes.
25524659 lentivirus-mediated AIOLOS overexpression in Jurkat cells induced cell apoptosis, arrested the cell cycle at the G0/G1 phase, and synergistically increased the sensitivity of Jurkat cells to etoposide by inhibiting NF-kappaB activity.
25446972 The immunosuppressive enzyme IL4I1 expressed differentially in human induced Aiolos+, but not natural Helios+, FOXP3+ Treg cells.
25271777 A strong association between rs907091 in the IKZF3 gene and SLE was identified.
25013050 Analysis of HIV-1 proviral integration sites in antiretroviral treatment patients indicates that IKZF3 gene favors HIV-1 integration for expansion and persistence of infected cells, suggesting HIV-1 IN interacts with IKZF3
25011556 Analysis of HIV-1 proviral integration sites in antiretroviral treatment patients indicates that IKZF3 gene favors HIV-1 integration for expansion and persistence of infected cells, suggesting HIV-1 IN interacts with IKZF3
25006012 NFKB1, CD27, LAG3 and IKZF3 are new susceptibility genes for psoriasis.
24823637 Aiolos reconfigures chromatin structure within the SHC1 gene, causing isoform-specific silencing of the anchorage reporter p66(Shc) and blocking anoikis in vitro and in vivo.
24406073 A strong allelic association between SNPs in the 17q21 region (IKZF3) and asthma has been confirmed for the Latinos population.
24399134 Overexpression of AIOLOS inhibits cell proliferation, suppresses apoptosis and arrests the cell cycle at the G0/G1 phase in vitro.
23333304 Analysis of HIV-1 proviral integration sites in antiretroviral treatment patients indicates that IKZF3 gene favors HIV-1 integration for expansion and persistence of infected cells, suggesting HIV-1 IN interacts with IKZF3
22626592 Sixteen SNPs were significantly associated with asthma of which one SNP was novel (IKZF3-rs1453559).
22464253 Four additional susceptibility loci (IRF8, TMEM39A, IKZF3, and ZPBP2) for systemic lupus erythematosus were robustly established a multiethnic population (European, African American, Asian, Hispanic, Gullah, and Amerindian).
21139082 To determine the consequences of Aiolos deregulation in B-CLL, we analyzed the effects of Aiolos overexpression or down-regulation on apoptosis.
20432734 distribution of positive and negative expression of Aiolos and Helios found in various types of leukemias could implicate common pathways of their regulation
19540588 we show for the first time the differential Aiolos expression at the RNA and protein level in hematopoietic cell subpopulations.
19124506 Observational study of gene-disease association. (HuGE Navigator)
18978678 Observational study of gene-disease association. (HuGE Navigator)
18332232 showed Aiolos overexpression in primary lymphoma tissue
18206652 DNA methylation directs Aiolos silencing and chromatin status in tumor cell lines, while in primary cells is mainly regulated by histone modifications.
18184862 up-regulation of Aiolos, confirmed at protein level, seems independent of Aiolos promoter H3K9 acetylation and H3K4 trimethylation
17646674 this work demonstrates that the cellular activities of Aiolos isoforms are dependent on combinations of various functional domains arising from the differential splicing of mRNA transcripts
17383641 Retardation gels showed binding activity for Ikaros, NFkappaB and AP4 transcription factors and mutations in their binding sites abolish Aiolos promoter activity.
17296582 impairment of Aiolos activity in human leukemia is not based on deficient phosphorylation as had been demonstrated in experiments in vitro
17117180 Observational study of gene-disease association. (HuGE Navigator)
12574333 Aiolos knockout mice develop the symptoms of human systemic lupus erythematosus (SLE). This finding implicates Aiolos as a possible candidate gene for SLE.
11937265 Short isoforms of Aiolos were detected at low levels in bone marrow of normal volunters, but were not overexpressed in a patient with acute T-cell leukemia. Data for unaltered Aiolos indicates tumor suppressor function.

AA Sequence

MEDIQTNAELKSTQEQSVPAESAAVLNDYSLTKSHEMENVDSGEGPANEDEDIGDDSMKVKDEYSERDEN      1 - 70
VLKSEPMGNAEEPEIPYSYSREYNEYENIKLERHVVSFDSSRPTSGKMNCDVCGLSCISFNVLMVHKRSH     71 - 140
TGERPFQCNQCGASFTQKGNLLRHIKLHTGEKPFKCHLCNYACQRRDALTGHLRTHSVEKPYKCEFCGRS    141 - 210
YKQRSSLEEHKERCRTFLQSTDPGDTASAEARHIKAEMGSERALVLDRLASNVAKRKSSMPQKFIGEKRH    211 - 280
CFDVNYNSSYMYEKESELIQTRMMDQAINNAISYLGAEALRPLVQTPPAPTSEMVPVISSMYPIALTRAE    281 - 350
MSNGAPQELEKKSIHLPEKSVPSERGLSPNNSGHDSTDTDSNHEERQNHIYQQNHMVLSRARNGMPLLKE    351 - 420
VPRSYELLKPPPICPRDSVKVINKEGEVMDVYRCDHCRVLFLDYVMFTIHMGCHGFRDPFECNMCGYRSH    421 - 490
DRYEFSSHIARGEHRALLK                                                       491 - 509
//

Text Mined References (60)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
27080863 2016 Allelic imbalance of multiple sclerosis susceptibility genes IKZF3 and IQGAP1 in human peripheral blood.
26546109 2016 Overexpression of Aiolos in Peripheral Blood Mononuclear Cell Subsets from Patients with Systemic Lupus Erythematosus and Rheumatoid Arthritis.
26185311 2015 Adult Low-Hypodiploid Acute B-Lymphoblastic Leukemia With IKZF3 Deletion and TP53 Mutation: Comparison With Pediatric Patients.
25620289 2015 The allele T of rs10852936 confers risk for early-onset psoriasis.
25608224 2015 Overexpression of Aiolos in Nalm-6 acute lymphoblastic leukaemia cells reduces apoptosis by suppressing phosphatase and tensin homologue deleted on chromosome 10 and activating the phosphatidylinositol-3-kinase/Akt signalling pathway.
25524659 2015 Upregulation of AIOLOS induces apoptosis and enhances etoposide chemosensitivity in Jurkat leukemia cells.
25446972 2015 Differential expression of the immunosuppressive enzyme IL4I1 in human induced Aiolos+, but not natural Helios+, FOXP3+ Treg cells.
25416956 2014 A proteome-scale map of the human interactome network.
25271777 2014 Association between polymorphisms of the IKZF3 gene and systemic lupus erythematosus in a Chinese Han population.
25006012 2014 Sequencing-based approach identified three new susceptibility loci for psoriasis.
24823637 2014 Aiolos promotes anchorage independence by silencing p66Shc transcription in cancer cells.
24406073 2014 Genome-wide association study and admixture mapping identify different asthma-associated loci in Latinos: the Genes-environments & Admixture in Latino Americans study.
24399134 2014 Overexpression of AIOLOS inhibits cell proliferation and suppresses apoptosis in Nalm-6 cells.
24388013 2014 Genome-wide association analysis identifies 11 risk variants associated with the asthma with hay fever phenotype.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23817569 2013 A genome-wide association meta-analysis of self-reported allergy identifies shared and allergy-specific susceptibility loci.
23740937 2013 A systemic sclerosis and systemic lupus erythematosus pan-meta-GWAS reveals new shared susceptibility loci.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
23000144 2012 Genome-wide association study identifies TNFSF15 and POU2AF1 as susceptibility loci for primary biliary cirrhosis in the Japanese population.
22626592 2012 17q12-21 variants are associated with asthma and interact with active smoking in an adult population from the United Kingdom.
22464253 2012 Identification of IRF8, TMEM39A, and IKZF3-ZPBP2 as susceptibility loci for systemic lupus erythematosus in a large-scale multiracial replication study.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21297633 2011 Meta-analysis identifies 29 additional ulcerative colitis risk loci, increasing the number of confirmed associations to 47.
21269460 2011 Initial characterization of the human central proteome.
21248752 2011 Exome sequencing identifies frequent mutation of the SWI/SNF complex gene PBRM1 in renal carcinoma.
21139082 2011 Deregulation of Aiolos expression in chronic lymphocytic leukemia is associated with epigenetic modifications.
21102463 2010 Genome-wide meta-analysis increases to 71 the number of confirmed Crohn's disease susceptibility loci.
20676092 2010 Activation of the aryl hydrocarbon receptor induces human type 1 regulatory T cell-like and Foxp3(+) regulatory T cells.
20639880 2010 Genome-wide meta-analyses identify three loci associated with primary biliary cirrhosis.
20453842 2010 Genome-wide association study meta-analysis identifies seven new rheumatoid arthritis risk loci.
20432734 2010 Analysis of Ikaros family splicing variants in human hematopoietic lineages.
19540588 2010 Differential aiolos expression in human hematopoietic subpopulations.
19458352 2009 Primary biliary cirrhosis associated with HLA, IL12A, and IL12RB2 variants.
19124506 2009 Common genetic variation in candidate genes and susceptibility to subtypes of breast cancer.
18978678 2008 Candidate gene/loci studies in cleft lip/palate and dental anomalies finds novel susceptibility genes for clefts.
18332232 2008 Aberrant Ikaros, Aiolos, and Helios expression in Hodgkin and non-Hodgkin lymphoma.
18206652 2008 Differential epigenetic regulation of Aiolos expression in human tumoral cell lines and primary cells.
18184862 2008 The Aiolos transcription factor is up-regulated in chronic lymphocytic leukemia.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17646674 2007 Combinatorial effects of splice variants modulate function of Aiolos.
17383641 2007 Critical function of Ikaros in controlling Aiolos gene expression.
17296582 2007 A search for a mutation of the Aiolos phosphorylation domain in lymphocytes from patients with leukemia.
17117180 2006 HapMap-based study of the 17q21 ERBB2 amplicon in susceptibility to breast cancer.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12574333 2003 Lack of the transcriptional coactivator OBF-1 prevents the development of systemic lupus erythematosus-like phenotypes in Aiolos mutant mice.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12015313 2002 A molecular dissection of the repression circuitry of Ikaros.
11997672 2002 Aiolos and Ikaros: regulators of lymphocyte development, homeostasis and lymphoproliferation.
11937265 2002 Overexpression of novel short isoforms of Helios in a patient with T-cell acute lymphoblastic leukemia.
11745366 2001 Both normal and leukemic B lymphocytes express multiple isoforms of the human Aiolos gene.
11714801 2001 The association of Aiolos transcription factor and Bcl-xL is involved in the control of apoptosis.
10978333 2000 Eos and pegasus, two members of the Ikaros family of proteins with distinct DNA binding activities.
10766745 2000 Ikaros interactions with CtBP reveal a repression mechanism that is independent of histone deacetylase activity.
10552935 1999 Human aiolos, an ikaros-related zinc finger DNA binding protein: cDNA cloning, tissue expression pattern, and chromosomal mapping.
10369681 1999 Aiolos transcription factor controls cell death in T cells by regulating Bcl-2 expression and its cellular localization.
9806640 1998 Aiolos regulates B cell activation and maturation to effector state.
9155026 1997 Aiolos, a lymphoid restricted transcription factor that interacts with Ikaros to regulate lymphocyte differentiation.