Property Summary

NCBI Gene PubMed Count 30
PubMed Score 81.89
PubTator Score 159.09

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma -4.944 7.6e-15

Gene RIF (3)

AA Sequence

MRPGTGQGGLEAPGEPGPNLRQRWPLLLLGLAVVTHGLLRPTAASQSRALGPGAPGGSSRSSLRSRWGRF      1 - 70
LLQRGSWTGPRCWPRGFQSKHNSVTHVFGSGTQLTVLSQPKATPSVTLFPPSSEELQANKATLVCLMNDF     71 - 140
YPGILTVTWKADGTPITQGVEMTTPSKQSNNKYAASSYLSLTPEQWRSRRSYSCQVMHEGSTVEKTVAPA    141 - 210
ECS                                                                       211 - 213
//

Text Mined References (32)

PMID Year Title