Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.00
PubTator Score 2.45

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
chronic lymphosyte leukemia -2.800 2.4e-06
Chronic obstructive pulmonary disease -1.300 1.5e-02
cystic fibrosis and chronic rhinosinusit... 1.529 1.8e-02
interstitial cystitis 3.300 1.1e-02
lung adenocarcinoma 1.300 1.2e-08
lung cancer -3.000 5.7e-06
Multiple myeloma -2.821 6.7e-04
non-small cell lung cancer 1.316 7.6e-04
osteosarcoma -6.042 3.2e-11
pancreatic cancer 1.100 1.6e-02
periodontitis 2.600 4.6e-29
primary pancreatic ductal adenocarcinoma 1.442 1.8e-02
tuberculosis 1.700 9.2e-04
ulcerative colitis 4.200 5.4e-07

PDB (11)

AA Sequence

MVLQTQVFISLLLWISGAYGDIVMTQSPDSLAVSLGERATINCKSSQSVLYSSNNKNYLAWYQQKPGQPP      1 - 70
KLLIYWASTRESGVPDRFSGSGSGTDFTLTISSLQAEDVAVYYCQQYYSTP                        71 - 121
//

Text Mined References (16)

PMID Year Title