Property Summary

NCBI Gene PubMed Count 31
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
Multiple myeloma -6.419 2.4e-05
esophageal adenocarcinoma 2.500 2.1e-02
cutaneous lupus erythematosus 3.100 4.3e-02
osteosarcoma -6.311 1.1e-08
periodontitis 2.300 1.1e-22
tuberculosis 1.600 1.4e-04
X-linked agammaglobulinemia -2.490 1.7e-03
intraductal papillary-mucinous neoplasm ... -2.800 1.8e-02
lung cancer -2.600 1.5e-05
interstitial cystitis 5.100 3.6e-03
lung adenocarcinoma 2.300 5.7e-13
posterior fossa group A ependymoma 1.300 8.8e-03
sonic hedgehog group medulloblastoma 1.300 2.5e-02
primary Sjogren syndrome 2.700 1.0e-02
lung carcinoma -2.000 2.4e-08
non-small cell lung carcinoma 1.700 1.8e-10
Breast cancer -1.500 8.1e-03
acute myeloid leukemia -1.800 2.7e-02
ulcerative colitis 3.400 9.5e-07
ovarian cancer 2.200 4.4e-02
chronic rhinosinusitis 2.237 3.9e-02
pancreatic cancer 2.100 4.5e-02

Gene RIF (6)

PMID Text
24141767 Rearrangement of the immunoglobulin mu-chain gene is associated with acute myeloid leukemia.
22305633 Serum immunoglobulin M anti-phosphorylcholine titers provide prognostic information for risk factors in acute coronary syndrome.
18515657 tracked the clonal history of tumor cells by studying mutations on the switch mu region of the der(14)t(14;18) during the early phase of the class-switch recombination
18174230 Observational study of gene-disease association. (HuGE Navigator)
15591116 lower levels of B-cell receptor surface expression observed in chronic lymphocytic leukemia are accounted for by an impaired glycosylation and folding of the mu and CD79a chains.
11839670 Intraclonal homogeneity of clonotypic immunoglobulin M and diversity of nonclinical post-switch isotypes in multiple myeloma: insights into the evolution of the myeloma clone

AA Sequence

GSASAPTLFPLVSCENSPSDTSSVAVGCLAQDFLPDSITLSWKYKNNSDISSTRGFPSVLRGGKYAATSQ      1 - 70
VLLPSKDVMQGTDEHVVCKVQHPNGNKEKNVPLPVIAELPPKVSVFVPPRDGFFGNPRKSKLICQATGFS     71 - 140
PRQIQVSWLREGKQVGSGVTTDQVQAEAKESGPTTYKVTSTLTIKESDWLGQSMFTCRVDHRGLTFQQNA    141 - 210
SSMCVPDQDTAIRVFAIPPSFASIFLTKSTKLTCLVTDLTTYDSVTISWTRQNGEAVKTHTNISESHPNA    211 - 280
TFSAVGEASICEDDWNSGERFTCTVTHTDLPSPLKQTISRPKGVALHRPDVYLLPPAREQLNLRESATIT    281 - 350
CLVTGFSPADVFVQWMQRGQPLSPEKYVTSAPMPEPQAPGRYFAHSILTVSEEEWNTGETYTCVAHEALP    351 - 420
NRVTERTVDKSTGKPTLYNVSLVMSDTAGTCY                                          421 - 452
//

Text Mined References (38)

PMID Year Title
25645918 2015 Human neutrophils secrete bioactive paucimannosidic proteins from azurophilic granules into pathogen-infected sputum.
24963139 2014 B cell activation involves nanoscale receptor reorganizations and inside-out signaling by Syk.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24145934 2013 Characterization, quantification, and assessment of immune protection potential of secretory immunoglobulin A in colostrum samples from Saudi women.
24141767 2014 Rearrangement and expression of the immunoglobulin ?-chain gene in human myeloid cells.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23250751 2013 Human plasma-derived polymeric IgA and IgM antibodies associate with secretory component to yield biologically active secretory-like antibodies.
22516433 2012 Proteomic analysis of microvesicles from plasma of healthy donors reveals high individual variability.
22427638 2012 Vigorous response of human innate functioning IgM memory B cells upon infection by Neisseria gonorrhoeae.
22305633 2013 IgM-phosphorylcholine autoantibodies and outcome in acute coronary syndromes.
21786026 2011 Antigenic specificity and expression of a natural idiotope on human pentameric and hexameric IgM polymers.
21269460 2011 Initial characterization of the human central proteome.
19214191 2009 Signalling of the BCR is regulated by a lipid rafts-localised transcription factor, Bright.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
19139490 2009 A strategy for precise and large scale identification of core fucosylated glycoproteins.
18515657 2008 S(mu) mutation patterns suggest different progression pathways in follicular lymphoma: early direct or late from FL progenitor cells.
18174230 2008 Association of polymorphisms in complement component C3 gene with susceptibility to systemic lupus erythematosus.
16895553 2006 The riddle of the dual expression of IgM and IgD.
16502470 2006 Human colostrum: identification of minor proteins in the aqueous phase by proteomics.
15591116 2005 Lower levels of surface B-cell-receptor expression in chronic lymphocytic leukemia are associated with glycosylation and folding defects of the mu and CD79a chains.
14760718 2004 Screening for N-glycosylated proteins by liquid chromatography mass spectrometry.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9661813 1998 Variation in IgG1 heavy chain allotype does not contribute to differences in biological activity of two human anti-Rhesus (D) monoclonal antibodies.
8890099 1996 Mutations in the mu heavy-chain gene in patients with agammaglobulinemia.
8417370 1993 Comparison of complete nucleotide sequence of the human IgM heavy chain constant region of polyreactive and monoreactive antibodies.
6795593 1981 Human immunoglobulin heavy chain genes: evolutionary comparisons of C mu, C delta and C gamma genes and associated switch sequences.
6777778 1980 Cloning and partial nucleotide sequence of human immunoglobulin mu chain cDNA from B cells and mouse-human hybridomas.
6777162 1980 The primary structure of the constant part of mu-chain-disease protein BOT.
4803843 [The primary structure of a monoclonal IgM-immunoglobulin (macroglobulin Gal.), II: the amino acid sequence of the H-chain (mu-type), subgroup H III. Architecture of the complete IgM-molecule (author's transl)].
4742735 1973 Complete amino acid sequence of the Mu heavy chain of a human IgM immunoglobulin.
3137579 1988 Functional differences between immunoglobulins M and D expressed on the surface of an immature B-cell line.
2505237 1989 The complete nucleotide sequence of a human immunoglobulin genomic C mu gene.
2115996 1990 Complete nucleotide sequence of the membrane form of the human IgM heavy chain.
1904154 1991 mRNA transcripts initiating within the human immunoglobulin mu heavy chain enhancer region contain a non-translatable exon and are extremely heterogeneous at the 5' end.
1446073 1992 An estimate of the sequencing error frequency in the DNA sequence databases.