Property Summary

NCBI Gene PubMed Count 4
PubMed Score 3.75
PubTator Score 3.20

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Essential Hypertension 92 0.0 0.8
Disease Target Count Z-score Confidence
Umbilical hernia 88 4.021 2.0

Expression

Synonym

Accession Q8WX77
Symbols IGFBPRP4
IGFBP-RP4
bA113O24.1

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (3)

AA Sequence

MPRLSLLLPLLLLLLLPLLPPLSPSLGIRDVGGRRPKCGPCRPEGCPAPAPCPAPGISALDECGCCARCL      1 - 70
GAEGASCGGRAGGRCGPGLVCASQAAGAAPEGTGLCVCAQRGTVCGSDGRSYPSVCALRLRARHTPRAHP     71 - 140
GHLHKARDGPCEFAPVVVVPPRSVHNVTGAQVGLSCEVRAVPTPVITWRKVTKSPEGTQALEELPGDHVN    141 - 210
IAVQVRGGPSDHEATAWILINPLRKEDEGVYQCHAANMVGEAESHSTVTVLDLSKYRSFHFPAPDDRM      211 - 278
//

Text Mined References (5)

PMID Year Title