Property Summary

NCBI Gene PubMed Count 1,598
PubMed Score 22748.03
PubTator Score 13414.46

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count
Osteoporosis 363
Hypogonadism 173
Abnormality of metabolism/homeostasis 134
Adverse reaction to drug 61
Alcohol abuse 50
Alcoholic Intoxication 34
Alzheimer's disease 658
Attention deficit hyperactivity disorder 278
Autosomal recessive predisposition 1442
Bilateral fifth finger clinodactyly 110
Bipolar Disorder 666
Bladder Neoplasm 112
Blepharoptosis 231
Congenital anomaly of face 56
Congenital clinodactyly 57
Congenital sensorineural hearing loss 12
Curvature of digit 57
Curvature of little finger 110
Delayed bone age 136
Delirium 10
Depressive disorder 409
Diabetes Mellitus, Insulin-Dependent 48
Diaphragmatic Hernia 40
Distortion of face 46
Dull intelligence 645
Dysmorphic facies 46
Failure to gain weight 365
Fetal Growth Retardation 189
Funny looking face 46
Generalized osteopenia 99
Hyperactive behavior 91
Hyperbilirubinemia, Neonatal 5
Hypertensive disease 292
Hypoplastic mandible condyle 275
Infant, Small for Gestational Age 176
Insulin Resistance 72
Intellectual disability 1016
Intrauterine retardation 176
Late tooth eruption 61
Low Birth Weights 69
Low intelligence 645
Mammary Neoplasms 425
Mandibular hypoplasia 275
Mental Depression 333
Mental Retardation 645
Mental deficiency 645
Metabolic Bone Disorder 11
Micrognathism 275
Mild Mental Retardation 70
Motor delay 147
No development of motor milestones 147
Osteopenia 99
Pediatric failure to thrive 365
Peripheral Neuropathy 134
Poor school performance 645
Precocious Puberty 28
Prelingual sensorineural hearing impairment 5
Prenatal onset 139
Radially deviated fingers 38
Reduced concentration span 9
Sensorineural Hearing Loss (disorder) 284
Sensorineural hearing loss, bilateral 18
Severe intrauterine growth retardation 3
Severe postnatal growth retardation 16
Short stature 531
Small for gestational age (disorder) 69
Small head 374
Small placenta 4
Spontaneous abortion 113
Underweight 17
Weight decreased 103
Weight less than 3rd percentile 17
facial deformity 46
Disease Target Count Z-score Confidence
Cancer 2499 6.411 3.2
Hypopituitarism 40 6.37 3.2
diabetes mellitus 1728 6.22 3.1
Laron syndrome 6 6.197 3.1
Obesity 678 5.736 2.9
Pituitary adenoma 38 5.65 2.8
Hyperinsulinism 133 5.352 2.7
Anorexia nervosa 80 5.254 2.6
Hypoglycemia 152 5.206 2.6
Hyperglycemia 137 5.064 2.5
Kidney disease 430 5.008 2.5
Polycystic ovary syndrome 360 4.837 2.4
Hypothyroidism 122 4.763 2.4
Myopathy 185 4.745 2.4
Retinopathy of prematurity 22 4.738 2.4
Hyperprolactinemia 27 4.588 2.3
Neurodegenerative disease 414 4.557 2.3
Arthritis 290 4.337 2.2
Heart disease 306 4.322 2.2
Donohue syndrome 6 4.287 2.1
Prader-Willi syndrome 48 4.279 2.1
Liver disease 237 4.165 2.1
Diabetic retinopathy 56 4.159 2.1
Amenorrhea 58 4.055 2.0
Hyperandrogenism 34 4.035 2.0
Coronary artery disease 268 3.992 2.0
Atherosclerosis 291 3.97 2.0
Craniopharyngioma 16 3.937 2.0
Hyperthyroidism 53 3.833 1.9
Goiter 38 3.752 1.9
Cerebrovascular disease 238 3.746 1.9
Sleep apnea 7 3.639 1.8
Cushing's syndrome 48 3.636 1.8
Metabolic acidosis 90 3.627 1.8
Infertility 188 3.603 1.8
Short bowel syndrome 16 3.581 1.8
McCune Albright syndrome 19 3.57 1.8
protein-energy malnutrition 8 3.497 1.7
Lung disease 142 3.312 1.7
Anovulation 21 3.306 1.7
Neuropathy 261 3.305 1.7
Brain disease 96 3.294 1.6
Skin disease 66 3.277 1.6
Lipid metabolism disorder 114 3.26 1.6
Inflammatory bowel disease 151 3.254 1.6
Silver-Russell syndrome 39 3.253 1.6
Diffuse idiopathic skeletal hyperostosis 6 3.249 1.6
Placental insufficiency 18 3.246 1.6
Hyperparathyroidism 48 3.243 1.6
Keratopathy 12 3.227 1.6
Graves' disease 24 3.185 1.6
Anemia 365 3.075 1.5
Dementia 175 3.055 1.5
Pituitary hypoplasia 23 3.04 1.5

Expression

  Differential Expression (29)

See source...

Protein-protein Interaction (7)

PDB (19)

Gene RIF (1591)

AA Sequence

MGKISSLPTQLFKCCFCDFLKVKMHTMSSSHLFYLALCLLTFTSSATAGPETLCGAELVDALQFVCGDRG      1 - 70
FYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSARSVRAQRHTDMPKTQKYQPPST     71 - 140
NKNTKSQRRKGWPKTHPGGEQKEGTEASLQIRGKKKEQRREIGSRNAECRGKKGK                   141 - 195
//

Text Mined References (1603)

PMID Year Title