Property Summary

NCBI Gene PubMed Count 24
PubMed Score 65.35
PubTator Score 41.37

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
posterior fossa group B ependymoma 1.900 1.3e-10
group 3 medulloblastoma 1.400 4.3e-04
ovarian cancer -1.400 1.9e-06
chronic rhinosinusitis -1.356 1.1e-02

Gene RIF (7)

PMID Text
24346024 subtle regulation of IFT and associated cilia structure, tunes the wnt response controlling stem cell differentiation.
22974282 this work suggests that Tg737 is involved in the invasion and migration of hepatoma cells under hypoxia, with the involvement of the polycystin-1, IL-8, and TGF-beta1 signaling pathway
22941275 A mutation in IFT88 causes a hitherto unknown human ciliopathy.
21441926 Data show that IFT88 depletion induces mitotic defects in human cultured cells, in kidney cells from the IFT88 mouse mutant Tg737(orpk) and in zebrafish embryos.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20300861 The results indicate that loss of heterozygosity of the tumor suppressor gene Tg737 may play an important role in the carcinogenetic mechanism of liver cancer stem cells.
17264151 IFT88 is a centrosomal protein regulating G1-S transition in non-ciliated cells.

AA Sequence

MKFTNTKVQMMQNVHLAPETDEDDLYSGYNDYNPIYDIEELENDAAFQQAVRTSHGRRPPITAKISSTAV      1 - 70
TRPIATGYGSKTSLASSIGRPMTGAIQDGVTRPMTAVRAAGFTKAALRGSAFDPLSQSRGPASPLEAKKK     71 - 140
DSPEEKIKQLEKEVNELVEESCIANSCGDLKLALEKAKDAGRKERVLVRQREQVTTPENINLDLTYSVLF    141 - 210
NLASQYSVNEMYAEALNTYQVIVKNKMFSNAGILKMNMGNIYLKQRNYSKAIKFYRMALDQVPSVNKQMR    211 - 280
IKIMQNIGVTFIQAGQYSDAINSYEHIMSMAPNLKAGYNLTICYFAIGDREKMKKAFQKLITVPLEIDED    281 - 350
KYISPSDDPHTNLVTEAIKNDHLRQMERERKAMAEKYIMTSAKLIAPVIETSFAAGYDWCVEVVKASQYV    351 - 420
ELANDLEINKAVTYLRQKDYNQAVEILKVLEKKDSRVKSAAATNLSALYYMGKDFAQASSYADIAVNSDR    421 - 490
YNPAALTNKGNTVFANGDYEKAAEFYKEALRNDSSCTEALYNIGLTYEKLNRLDEALDCFLKLHAILRNS    491 - 560
AEVLYQIANIYELMENPSQAIEWLMQVVSVIPTDPQVLSKLGELYDREGDKSQAFQYYYESYRYFPCNIE    561 - 630
VIEWLGAYYIDTQFWEKAIQYFERASLIQPTQVKWQLMVASCFRRSGNYQKALDTYKDTHRKFPENVECL    631 - 700
RFLVRLCTDLGLKDAQEYARKLKRLEKMKEIREQRIKSGRDGSGGSRGKREGSASGDSGQNYSASSKGER    701 - 770
LSARLRALPGTNEPYESSSNKEIDASYVDPLGPQIERPKTAAKKRIDEDDFADEELGDDLLPE           771 - 833
//

Text Mined References (27)

PMID Year Title
25564561 2015 The kinetochore protein, CENPF, is mutated in human ciliopathy and microcephaly phenotypes.
24421332 2014 The CP110-interacting proteins Talpid3 and Cep290 play overlapping and distinct roles in cilia assembly.
24346024 2013 Surface topography regulates wnt signaling through control of primary cilia structure in mesenchymal stem cells.
23870195 2013 Genetics of coronary artery calcification among African Americans, a meta-analysis.
23064961 2013 GWAS of dental caries patterns in the permanent dentition.
22974282 2012 Tg737 signaling is required for hypoxia-enhanced invasion and migration of hepatoma cells.
22941275 2012 Gene therapy rescues cilia defects and restores olfactory function in a mammalian ciliopathy model.
21441926 2011 The cilia protein IFT88 is required for spindle orientation in mitosis.
20713499 2010 Cross-disorder genomewide analysis of schizophrenia, bipolar disorder, and depression.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20300861 2010 Loss of heterozygosity of the tumor suppressor gene Tg737 in the side population cells of hepatocellular carcinomas is associated with poor prognosis.
17264151 2007 The intraflagellar transport component IFT88/polaris is a centrosomal protein regulating G1-S transition in non-ciliated cells.
16751776 2006 A germline-specific class of small RNAs binds mammalian Piwi proteins.
16043481 2005 RPGR-ORF15, which is mutated in retinitis pigmentosa, associates with SMC1, SMC3, and microtubule transport proteins.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057823 2004 The DNA sequence and analysis of human chromosome 13.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14667819 2004 Analysis of a high-throughput yeast two-hybrid system and its use to predict the function of intracellular proteins encoded within the human MHC class III region.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11329013 2001 Creation of genome-wide protein expression libraries using random activation of gene expression.
11251073 2001 Polaris, a protein involved in left-right axis patterning, localizes to basal bodies and cilia.
10462374 1999 Structure and expression of Tg737, a putative tumor suppressor gene, in human hepatocellular carcinomas.
10200981 1999 New insights into the molecular pathophysiology of polycystic kidney disease.
9362446 1997 The tetratricopeptide repeat containing Tg737 gene is a liver neoplasia tumor suppressor gene.
8597639 1995 Sequence analysis of the human hTg737 gene and its polymorphic sites in patients with autosomal recessive polycystic kidney disease.
8191288 1994 Candidate gene associated with a mutation causing recessive polycystic kidney disease in mice.
7633404 1995 Characterization of the human homologue of the mouse Tg737 candidate polycystic kidney disease gene.