Property Summary

NCBI Gene PubMed Count 8
PubMed Score 98.17
PubTator Score 22.57

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
malignant mesothelioma -1.100 3.2e-05
posterior fossa group B ependymoma 2.500 4.1e-15
glioblastoma 1.400 1.7e-07
group 3 medulloblastoma 1.800 3.6e-05
atypical teratoid/rhabdoid tumor 1.700 6.6e-10
primitive neuroectodermal tumor 1.600 4.8e-06
lung cancer 1.500 8.8e-04
diabetes mellitus -1.200 1.0e-03
pediatric high grade glioma 1.300 9.8e-06
acute myeloid leukemia -1.100 2.8e-02

 MGI Phenotype (1)

Gene RIF (2)

PMID Text
23990561 this study found that the two core intraflagellar transport proteins IFT74 and IFT81 form a tubulin-binding module and mapped the interaction to a calponin homology domain of IFT81 and a highly basic domain in IFT74.
12549821 inconsistent expression levels of human CDV-1 and mouse Cdv-1 in heart implied that cardiac hypertrophy in human SCD might not be associated with the abnormal expression of CDV-1

AA Sequence

MSDQIKFIMDSLNKEPFRKNYNLITFDSLEPMQLLQVLSDVLAEIDPKQLVDIREEMPEQTAKRMLSLLG      1 - 70
ILKYKPSGNATDMSTFRQGLVIGSKPVIYPVLHWLLQRTNELKKRAYLARFLIKLEVPSEFLQDETVADT     71 - 140
NKQYEELMEAFKTLHKEYEQLKISGFSTAEIRKDISAMEEEKDQLIKRVEHLKKRVETAQNHQWMLKIAR    141 - 210
QLRVEKEREEYLAQQKQEQKNQLFHAVQRLQRVQNQLKSMRQAAADAKPESLMKRLEEEIKFNLYMVTEK    211 - 280
FPKELENKKKELHFLQKVVSEPAMGHSDLLELESKINEINTEINQLIEKKMMRNEPIEGKLSLYRQQASI    281 - 350
ISRKKEAKAEELQEAKEKLASLEREASVKRNQTREFDGTEVLKGDEFKRYVNKLRSKSTVFKKKHQIIAE    351 - 420
LKAEFGLLQRTEELLKQRHENIQQQLQTMEEKKGISGYSYTQEELERVSALKSEVDEMKGRTLDDMSEMV    421 - 490
KKLYSLVSEKKSALASVIKELRQLRQKYQELTQECDEKKSQYDSCAAGLESNRSKLEQEVRRLREECLQE    491 - 560
ESRYHYTNCMIKNLEVQLRRATDEMKAYISSDQQEKRKAIREQYTKNTAEQENLGKKLREKQKVIRESHG    561 - 630
PNMKQAKMWRDLEQLMECKKQCFLKQQSQTSIGQVIQEGGEDRLIL                            631 - 676
//

Text Mined References (12)

PMID Year Title
23990561 2013 Molecular basis of tubulin transport within the cilium by IFT74 and IFT81.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21269460 2011 Initial characterization of the human central proteome.
18088087 2008 Phosphoproteome of resting human platelets.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15955805 2005 Characterization of the intraflagellar transport complex B core: direct interaction of the IFT81 and IFT74/72 subunits.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12549821 2002 Identification of human CDV-1R and mouse Cdv-1R, two novel proteins with putative signal peptides, especially highly expressed in testis and increased with the male sex maturation.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11130971 2000 Genomic organization and mapping of mouse CDV (carnitine deficiency-associated gene expressed in ventricle)-1 and its related CDV-1R gene.