Property Summary

NCBI Gene PubMed Count 455
PubMed Score 1189.71
PubTator Score 1119.11

Knowledge Summary

Patent

No data available

Gene RIF (464)

PMID Text
27522730 Combination of blood group specificity and interleukin 28B gene polymorphism is a simple and reliable predictor of sustained virologic response and dynamics of fibrosis.
27156332 significant effects of IL-28B G allele carriers on susceptibility to HCV infection com-pared to the other allele (T).
27100663 IL28B polymorphism is associated with response to therapy in HCV Genotype 4.
27058339 The rate of CC allele in IL-28B rs12979860 gene was the highest in immune subjects, while it was the lowest in chronic hepatitis B patients. IL-28B rs12979860 gene polymorphisms were not effective on the clinical course of HBV infection
26911666 Vitamin D related (VDR rs2228570 and CYP2R1 rs10741657) and IL28B rs12979860 genes polymorphisms accurately assure sustained viral response in naive CHC G4 patients treated with low cost standard therapy.
26896692 that IFN-lambda4 protein expression associated with the IL28B-T/T variant preactivates the Janus kinase-Stat signaling, leading to impaired HCV clearance by both IFN-alpha and IFN-lambda
26741362 The described is the association with spontaneous hepatitis C viral clearance and genetic differentiation of IL28B/IFNL4 haplotypes in populations from Mexico.
26732192 Core aa70 mutation and the IL28B non-TT genotype were identified as independent factors that influenced relapse after achievement of ETR for telaprevir-based triple therapy.
26699619 IFNL3 SNPs were associated with virological response in patients with chronic hepatitis C.
26670100 The association of IL28B and APOH single nucleotide polymorphisms (SNPs) with sustained virological response and of ITPA SNPs with anemia related phenotypes.
26660164 Both the favorable IL28B rs8099917 genotype and female sex were associated with the spontaneous clearance of hepatitis C virus infection in this Japanese population.
26614853 The association of IL28B gene polymorphisms with the treatment response points to the possibility of personalized medicine for the treatment of HCV infection
26609200 No significant association between the serum cytokine levels and the presence of the rs12979860 SNP of il-28B in symptomatic and asymptomatic subjects was observed
26606750 data on ex vivo derived liver tissue samples argue against an attenuating impact of IFNL3 rs4803217 or IFNL4 rs368234815 minor alleles on hepatic IFNL3 gene expression in vivo.
26602024 In participants with HCV genotype 1, unfavorable genotypes for HCV clearance near IFNL3 were associated with increased HCC risk, the adjusted odds ratio (95% CI) for rs12979860 and rs8099917 being 1.73 and 1.84, respectively.
26599080 analysis of PNPLA3 (rs738409) and IL28B (rs12979860) SNPs in HIV/HCV coinfected patients reveals no impact on liver disease or treatment response
26546777 Data show that genotype TT (rs8099917) of the interleukin-28B (IL28B) gene might be a risk factor for elevation of the proviral load and CD8(+) T cell count.
26526510 Interleukin-28B polymorphism could be a possible predictor of response to pegylated interferon/ribavirin therapy
26485009 Genetic polymorphisms of IL28b gene is associated with response to drug therapy in HCV and HIV/HCV-infected patients.
26400298 Polymorphism within the IL-28R1, but not in IL-28B, is associated with benign prostatic hyperplasia and lower urinary tract symptoms in Chinese.
26394672 The IL28B single-nucleotide polymorphisms rs12979860 and rs8099917, but not TNF-alpha single-nucleotide polymorphism rs1800629, are associated with the clinical outcome of Andes virus-induced disease.
26378651 Three out of the 110 SNPs were found to be associated with HCV outcome (P-values<0.03). rs11506105 in EGFR (epidermal growth factor receptor gene), and rs11881222 and rs12979860 in IL28B (interferon-lambda3 gene).
26352693 IL28B and PNPLA3 genotypes are associated with rapid fibrosis progression, and the progression rate -score identifies patients who has a high risk of fibrosis progression and require urgent antiviral treatment
26339796 Association has been found between CXCL10 and DPP4 gene polymorphisms and a complementary role for unfavorable IL28B genotype in prediction of treatment response in Thai patients with chronic hepatitis C virus infection.
26281194 In the LN patients, the carriage of the mutant IL-10 allele A is associated with a better response to treatment and that of the mutant IL-28 allele is linked to the severe course of the disease.
26280154 study conducted to determine the association of IL-28B rs12980275, rs12979860, and rs8099917 gene polymorphism(s) with the response (including relapse) following dual pegIFN and ribavirin therapy in genotype 4 hepatitis C Egyptian patients; SNPs at IL-28/60 and IL-28/75 are possible predictors of relapse in patients receiving dual treatment
26269684 The IL28B rs12979860 CC genotype was associated with SVR in hepatitis C patients receiving pegylated interferon plus ribavirin.
26259026 Steatosis severity was independently associated with IL28B rs12979860 in large cohort of patients with genotype 1 Chronic hepatitis C.
26194286 Studies indicate that the type III interferons (IFNs) or IFN-lambdas consists of four members: IFN-lambda1 (IL-29), IFN-lambda2 (IL28A), IFN-lambda3 (IL-28B) and IFN-lambda4.
26177560 IL28B could be used as a prognostic marker.
26156685 The three most widely studied SNPs near the IL28B gene were associated with sustained virological response following antivirological treatment of chronic hepatitis C in hemodialysis patients.
26150150 IFNL3 and IFNL4 genotyping could identify those likely to clear naturally and in whom treatment could be delayed, or help prioritize Directly-acting antivirals treatment to those less likely to respond to interferon-containing regimens.
26115445 The current study is the first to investigate the effect of IFNL3 and IFNL4 polymorphisms on liver-related mortality. The lower risk of death among African American HIV/HCV-coinfected women is not explained by genetic variation in the IFN-lambda region.
26109548 IFNL3 genotype is associated with differential induction of IFNL3 in primary human hepatocytes
26079279 The association of IL-28B and CTLA-4 polymorphisms and HCV F protein in the risk and chronicity of HCV infection in Chinese Han population in Southeast China.
26060059 IL28B genotype in patients with hepatitis C virus-associated mixed cryoglobulinemia affects the response to PEG-IFN and ribavirin treatment.
26034208 Altered effector functions of NK cells in chronic hepatitis C are associated with IFNL3 polymorphism.
26022419 In occult hepatitis B infection (OBI) donors, IL28B CC correlates with the intensity of HBV-specific T-cell responses;IL28B CC is not statistically associated with OBI or with HBV clearance
26021070 Evaluation of the antiviral therapy for chronic hepatitis C in patients unresponsive to previous treatment with regard to the interleukin-28B genotypes
25971683 IL28B.rs12979860 genotype could not predict the outcome of hepatitis C virus-specific cellular immune response.
25970604 findings confirm that the rs12979860 CC, rs8099917 TT, and rs12980275 AA genotype-carriers have favorable responses to standard hepatitis C therapy [review]
25962810 Meta-analysis showed that T allele of rs12979680 IL28B polymorphism increases risk of hepatitis B (HBV) infection in Chinese but not Asian populations. There is no association between rs8099917 and HBV infection in Chinese or Asian populations.
25958342 The IL-28B rs12979860 SNP is associated with antiviral treatment efficacy in chronic hepatitis C.
25938745 IL28B SNPs of the recipient play a major role in IFN-induced blocking of HCV replication.
25936570 CC genotype in IL28B; had 8.547 folds higher chance to develop sustained virological response than CT and TT genotypes (P = 0.014). IL28B gene (TG and GG genotypes) was found to be 3.348 more likely not to respond to treatment than the TT genotype.
25918016 a critical evaluation of interleukin 28B genotype as a pharmacogenetic predictor in hepatitis C patients. [meta-analysis]
25864220 Neither necroinflammation, bilirubin values or fibrosis stage seem to be related to IFNL3 polymorphisms.
25857516 the rs8099917 polymorphism was found strongly associated with virological response to therapy in Turkish patients infected with HCV genotype 1. We suggest determining IL28B gene polymorphism of patients with HCV genotype 1 before onset of treatment.
25852288 IL28B rs12980275 AA genotype is a strong predictor of positive response to IFN therapy in Chinese Han patients with hepatitis C.
25852275 In response-guided Peg-IFNalpha/RBV combination therapy for chronically HCV G2-infected patients, the impact of the IFNL3 genotype on SVR was limited to non-RVR patients.
25837166 Our data suggest that IL28B genetic variations may play an important role in long-term development of disease in chronic HBV infections.
25835418 this study demonstrated that IL-28B single nucleotide polymorphism associte with Cognitive Decline and Dementia.
25818002 This study suggests that in hepatitis C virus genotype 1-infected patients, there is no relationship between IL28B rs12979860 genotype and insulin resistance or circulating levels of soluble receptor 1 of TNFalpha.
25811035 This study indicates that variation at SNP rs8099917 could predict the serum levels of IL28B in HCV-infected patients.
25788203 The IFNL3.rs12979860 and IFNL4.ss469415590 variants have comparable effects on spontaneous resolution of hepatitis C virus infection among Egyptians.
25773845 IL-28 polymorphism rs8099917 strongly predicts virological response in hepatitis C virus infection
25773839 it was demonstrated that IL28B CC and CT alleles in HCV-3a and the IL28B CC allele in HCV-1a were significantly associated with response to pegIFN-alpha/RBV treatment. The present results may help identify subjects for whom the therapy might be successful.
25769643 AA genotype of rs12980275 was a predictive factor for SVR in HCV patients with PEG-IFN/RBV treatment, especially in HCV genotype 1/4.
25747035 genetic variations associated with susceptibility and outcomes of hepatitis c
25743001 Partial splenic embolism, in conjunction with triple combination therapy, is a useful and safe method to treat genotype 1b chronic hepatitis C patients with hypersplenism-induced thrombocytopenia
25735432 A long TA repeat in the promoter region of IL28B was associated with spontaneous HCV clearance.
25712648 IL28B polymorphism (rs12979860) is associated with clearance of HCV infection in Poland
25708904 The CC genotype of IL-28B SNP rs12979860 is an independent predictive factor for SVR in chronic HCV-infected patients in Pakistan
25687192 The treatment response of chronic hepatitis C depends on the IL28B genotype.
25675103 IFNL4 and IFNL3 associated polymorphisms strongly influence the spontaneous IFN-alpha receptor-1 expression in HCV-infected patients
25668821 IFNlambda3 rs12979860 SNP does not have any significant influence on long-term hepatitis D clearance.
25664396 A IL28B rs8099917T allele predisposes for susceptibility to chronic hepatitis B virus infection but not leading to hepatocellular carcinoma in the Thai population.
25663241 Patients who have favorable AA IL28B alleles have a lower prevalence of diabetes and related complications compared with patients with unfavorable IL28B rs12980275 genotype.
25611696 Single nucleotide polymorphisms (SNPs) near IL28B (IFNlambda3) are strongly associated with treatment response to IFNalpha therapy in chronic hepatitis C (CHC) patients.
25587616 No association was found between rs8099917 IL28B genotype and liver histology
25563035 Among Puerto Rican hepatitis C patients, the SNP frequencies of IFNL3 locus rs12979860 were 27% (C/C), 50% (C/T), and 23% (T/T), and for rs8099917 were 46% (T/T), 47% (T/G), and 7% (G/G).
25545640 The relation between hepatitis c virus genotypes, IL28B and development of liver stiffness, was investigated.
25503988 IL-28B as a key regulator of the Th1/Th2 balance during influenza vaccination.
25470790 IL28B genotype does not predict the week four response to telaprevir-based therapy in HIV-HCV-coinfected patients, regardless of their treatment history.
25461389 Data indicate that interferon lambda-3, interferon beta and interleukin-10 (IL-10, IFNlambda3 and IFNbeta) are up-regulated in tick-borne encephalitis.
25460552 Based on a retrospective study of patients treated for hepatitis C infection, the IFNL3 rs12979860 CT and TT polymorphisms are associated with a risk for hepatocellular carcinoma, especially in patients without a virologic response.
25420838 The CC genotype at rs12979860 of IL28B is a protective factor for new-onset diabetes mellitus after transplantation in patients with liver transplantation for HCV-related cirrhosis.
25391769 No significant difference in the distribution of IL28B genotypes was observed between normal controls and CHB patients.
25389973 In contrast to classical risk factors like tumor thickness and clinical stage, IL28B polymorphism was not associated with progression-free or overall survival in patients with melanoma treated with interferon alpha.
25355870 These results show that type III interferons (IFN-lambdas) play a critical protective role in human metapneumovirus infection.
25332265 No significant associations were found between IL28B rs12979860 genotypes with the risk of developing hepatocellular carcinoma in Turkish patients.
25312023 IL28B rs12979860 CC genotype is a significant predictor for sustained virological response and rapid virological response in Chinese Han patients with Chronic Hepatitis C.
25301956 Polymorphisms in the IFNL3/4 region influence susceptibility to cytomegalovirus replication in solid-organ transplant recipients.
25286525 Examination for IL28B gene SNP 39738787C>T is recommended before the start of IFN/RBV therapy in all the patients with genotype 1 HCV as a prognostic factor on the therapy response
25278709 IL28B genotyping may guide clinicians to offer personalized therapy to hepatitis C patients.
25256151 This study indicates that IFNL3 CC genotype predicts higher hepatitis C virus RNA levels in early acute hepatitis C virus infection.
25233462 multivariate model analysis showed IL28B polymorphisms were independently associated with HTLV-1-associated myelopathy/tropical spastic paraparesis(HAM/TSP)outcome in rs12979860 genotype CT and in rs8099917 genotype GG; subjects with SNP rs8099917 genotype GG and rs12979618 genotype CT may present a distinct immune response against HTLV-1 infection
25227816 IL28B rs12979860 C/T genotype is the commonest genotype in HCV-associated chronic hepatitis and hepatocellular carcinoma in Egypt. IL28B rs12979860 polymorphisms are not associated with disease progression or aggression .
25174990 BMI, male sex and IL28B genotype associated with persistently high hepatitis C virus RNA levels among chronically infected drug users
25132781 IL28B genotype was linked to an impact on early viral kinetics in response to PEG-IFN/RBV therapy in HCV-6 infected patients.
25115611 IL-28B SNPs are good predictors of response to combination therapy of HCV
25048205 In vitro responsiveness of peripheral blood mononuclear cells to IFN-alpha from genotype 1 infected patients predicts clinical responsiveness to dual therapy, independently of IL28B genotype.
25041342 polymorphisms did not correlated with hepatitis B virus natural clearance
25039676 Hepatitis C patients with IL28BCC, if genotype 1, are able to clear HCV more often than if genotype 2 and 3 infected; the CC genotype is associated with higher grade of necro-inflammation.
25034356 Our study showed that the IL28B genotype is used for the management of HCV-infected patients
25032184 The IL28B SNP did not influence the SVR rate in either the HCV genotype 1 or non-1 patients.
24999753 The IL28B rs12979860 CC and rs12979860 AA genotypes were significantly associated with sustained virological response in hepatitis C patients treated with Peg-IFN-alpha-2a and ribavirin.
24995561 SNP of IL28B was not associated with SVR in patients with HCV genotype 2
24994464 Low IL-10 serum levels is a key factor for predicting the sustained virological response to IFNalpha/ribavirin in Brazilian patients with hepatitis C virus carrying IL28B CT/TT genotype.
24969847 IL-28B rs8099917 and rs955155 and rs10853728 SNPs were found to be associated with sustained viral response in HCV-1- and HCV-2-infected patients; identified an interaction between MRC-1 rs691005 and IL-28B rs8099917 and response
24951853 The IL28B genotype has been found to have a strong influence on spontaneous clearance of acute Hepatitis C virus both in HCV mono- and HIV/ the HCV co-infected patients.
24929144 KIR3DL1-HLA-Bw4 combination and IL28B polymorphism predict response to Peg-IFN and ribavirin with and without telaprevir in chronic hepatitis C patients.
24927606 In patients with HCV-1 hepatitis and IL28B-CT/TT genotype, PNPLA3 allele G modulates development of liver steatosis.
24914551 The impact of interleukin 28B single nucleotide polymorphism (rs12979860, rs8099917) variability in hepatitis C virus genotype 3 infected populations, was evaluated.
24905495 IL28B C/C genotype was not associated with high liver fibrosis progression rate in HIV/HCV-coinfected patients
24905490 Apolipoprotein H expression is associated with IL28B Single Nucleotide Polymorphism and viral clearance in hepatitis C virus infection.
24898388 Data show interleukin 28B rs12979860 genotype association with interferon (IFN) treatment response in hepatitis C virus (HCV)-3a-infected patients.
24874053 Studies suggest that interleukin-28B (IL-28B) rs12979860 T/C polymorphism seems to augment the risk of developing hepatocellular carcinoma (HCC), especially in Caucasians.
24845613 IL28B has previously been identified as important for clearance of the Hepatitis C virus after established infection,not found to be relevant to resistance to Hepatitis C infection.
24840747 There were found a geographical distribution in the HCV genotypes, and a correlation between HCV genotypes and several IL-28B SNPs.
24840315 IL-28B polymorphisms may contribute to HBsAg persistence and the development of the inactive HBsAg carrier state.
24817780 The associations between the IL-28B rs12979860 and rs8099917 polymorphisms and the clinical manifestations of hepatitis B are not statistically significant.
24792632 present study showed that children with the rs12979860 C/C single nucleotide polymorphism of the interleukin 28B gene have a higher probability of spontaneous clearance of hepatitis C virus
24782280 IFNL3 and IFNL4 single nucleotide polymorphisms correlate with treatment response in hepatitis C patients depending on virus genotype.
24776764 At multivariate analysis, the genotype CC remained associated with severe portal inflammation in HCV-1, only IL28B genotype is associated with the histological features of chronic hepatitis C in a HCV genotype dependent manner, with CC genotype being independently associated with severe portal inflammation.
24770613 two recipient haplotype structures for IL28B were significantly associated with rapid fibrosis progression.
24768758 On-treatment rapid virological response (RVR) was predictive of sustained virologic response only in those individuals with IFNL3 non-responder genotypes (rs12979860 CT/TT and rs8099917 TG/GG)
24707497 patients with lymphoproliferative disorders had not any significantly different IL28B rs1297860 allelic distribution than those with chronic HCV
24678513 The results suggest a possible association of SNP rs8099917 with higher odds of chronic hepatitis c virus infection.
24672032 Reduction of microRNA 122 expression in IFNL3 CT/TT carriers and during progression of fibrosis in patients with chronic hepatitis C.
24662995 SNPs in IFNL3 and IFNL4 can be used to predict HCV treatment outcome in a population of Central Asian ancestry.
24659876 important role in hepatitis C virus infection[review]
24646752 could not find any difference in the predictive impact of any of three SNPs of IFNL4 or IL-28B with regard to susceptibility to HCV or treatment response
24637774 IL28B polymorphisms appeared to modify the natural course of chronic hepatitis C. Disease progression seems to be promoted in patients with the rs12979860 CC and rs8099917 TT genotypes (Meta-Analysis)
24620020 IL-28B single nucleotide polymorphisms may be associated with higher antiviral IFN-stimulated gene expression, which results in better cytomegalovirus replication control.
24599320 The impact of IL28B polymorphism on virological clearance is relative to other factors and was not significantly independent in hepatitis C.
24583931 In two cohorts of non-diabetic HCV patients where IL28B genotype predicted treatment outcome, we found no association between IL28B genotype and HOMA-IR.
24579307 single nucleotide polymorphisms of the IL28B gene are associated with viral clearance of HCV patients.[Review]
24553484 minor alleles of IL28B SNP were significantly associated with null or partial virological response in patients with HCV genotype 1, as were female gender, and low LDL cholesterol
24532585 Data indicate that IPS-1-dependent pathway plays a crucial role in type III IFN production by CD8(+) dendritic cells (DCs) and hepatocytes in response to hepatitis C virus (HCV), leading to cytoplasmic antiviral protein expressions.
24523350 In two cohorts of non-diabetic HCV patients where IL28B genotype predicted treatment outcome, we found no association between IL28B genotype and HOMA-IR.
24522196 rs12979860 polymorphism predicted spontaneous viral clearance and sustained virological response after antiviral therapy in haemophilic patients with HCV infection. Response rates were doubled in the CC genotype versus those with the T allele.
24517415 Genetic variations in IL28B may play a critical role in PEG-IFN efficacy in HBeAg-positive CHB patients in Han Chinese.
24516704 The IL28B SNP was an independent predictor of spontaneous clearance, favorable clinical outcomes of hepatitis C virus (HCV) infection, and sustained virologic response in genotype 1 HCV infection.
24480970 Genotype CC may influence anti-viral responses of IFN-lambda, thereby allowing better control of Epstein-Barr virus viraemia during lymphoproliferation, particularly in acute infectious mononucleosis.
24465773 The present study provides the evidence that the rs12979860 single nucleotide polymorphism of IFNL3 influences the natural history of hepatitis C virus in children.
24445571 IL-28B CC genotype is a good predictor of spontaneous or treatment induced resolution of acute hepatitis C infection.
24438679 the results in patients carrying the unfavourable CT/TT IL28B genotypes showed that plasma levels of both drugs have significant effects on viral kinetics and sustained virological response.
24438678 there was no significant association between common IL28B polymorphisms and the rate of spontaneous HBsAg seroclearance.
24415442 IL28b CT/TT genotype strongly correlates with treatment non-response in patients infected with HCV genotype 3 and CC genotype of IL28b is associated with higher quick viral response.
24398031 The IL28 rs12979860 SNP was determined in chronic HCV-1 patients. The IL28B CC genotype was rarer in HCV patients than controls. Distinct IL28B and IL10R allele combinations may be protective against chronic HCV1 and predictive of response to therapy.
24396987 Two SNPs (rs12979860, rs8099917) were genotyped in the IL28B locus from 175 DNA samples collected from HCV-infected consecutive patients in Italy.
24389274 HCV genotype 1 is the most prevalent in the world.1 In the present study, genotype 1 was also demonstrated in the highest frequency, followed by genotypes 3 and 2, respectively.
24387833 IL-28B polymorphisms rs12979860 and rs8099917 might not influence hepatitis delta clearance rate in either natural history or interferon-alpha response.
24385435 Interferon regulatory factor (IRF)-3 and -7 are the key transcriptional factors for the induction of IL-28A and IL-28B genes, whereas NF-kappaB is an additional requirement for the induction of the IL-29 gene.
24379268 Polymorphisms in the regulatory region of the Il-28B gene (SNP rs12979860, SNP rs8099917) play a very important role in predicting treatment outcome for hepatitis C infections. (review)
24374819 In conclusion the data presented pointed to a protective effect of the T allele (recessive genetic model) against cytomegalovirus infection in the allo-stem cell transplantation setting.
24349500 combinations of KIR3DL1/HLA-Bw4, KIR2DL2/HLA-C1, and a genetic variant of the IL28B gene are predictive of the response to PEG-IFN and ribavirin therapy in Japanese patients infected with genotype 1b HCV.
24335707 an association was identified between a cluster of interferon stimulated genes, the metallothioneins and IFNL3 genotype. metallothioneins are upregulated in HCV-infected livers from patients with favourable IFNL3 polymorphisms.
24325405 Its polymorphisms are strongly associated with responses to pegylated interferon (PEG-IFN) and ribavirin (RBV) therapy in patients chronically infected with hepatitis C virus.
24311440 Pretreatment up-regulation of hepatic interferon (IFN)-stimulated genes (ISGs) has a stronger association with the treatment-resistant interleukin (IL)28B minor genotype.
24302757 These data indicate that during chronic HCV infection, race-associated increase in NCR expression and IL28B-associated cytolytic activity may participate in host response to IFN-alpha-containing HCV therapy.
24293567 In HCV-positive patients with CV, the IL-28B C/C genotype is distinguished by a higher frequency of restriction of B cell response, a higher risk of cryoglobulinemic nephropathy and B cell malignancies, and is a predictor of response to antiviral therapy.
24287582 The IL28B TT genotype is the most important baseline factor for predicting sustained virological response in chronic hepatitis C Japanese patients treated with telaprevir-based therapy.
24269996 Results showed no association between genotypes and alleles of IL28A, IL28B or IL29 polymorphisms and Hepatitis C virus infection.
24259970 Higher allele frequency of IL-28B rs12979860 C and rs8099917 T SNPs observed in non-HCV-infected individuals may indicate a potential protective role for these IL28B-related polymorphisms.
24244641 IL28B genetic variants differently regulate the course of hepatitis C infection across hepatitis C virus genotypes.
24241692 Data indicate that hepatitis C virus (HCV) was able to induce two microRNAs (miRNAs), miR-208b and miR-499a-5p, that target the interferon-lambda3 (IFN-lambda3) 3' untranslated region (3' UTR).
24222948 Review: IFNL3 polymorphisms are associated with a higher serum lipid profile, and less frequent steatosis and insulin resistance in chronic hepatitis C.
24204859 A clear association between IFNL3 genotypes and baseline parameters known to impact interferon responsiveness.
24188401 These results demonstrate that IL28B genotype influences lipid metabolism in patients with hepatitis C but not in noninfected and it seems to be viral genotype-mediated.
24167602 A fast and cost-effective method for identifying a polymorphism of interleukin 28B related to hepatitis C.
24144988 Study indicates that the four SNPs in IL28B are correlated with susceptibility to Hepatitis C virus infection.
24118788 Genetic variations in IL28B gene region may influence the clearance of HBV infection.
24117654 Its single nucleotide polymorphism still remained informative as a predictor of SVR to 24-week telaprevir-based triple combination therapy for East Asian patients infected with hepatitis C virus genotype 1b.
24116050 In patients with chronic hepatitis C, an SNP rs28416813 in the distal promoter region of IL28B that is in close proximity to a non-consensus NF-kappaB-binding site affects downstream reporter gene expression.
24102823 Favourable alleles of both rs12979860 and rs8099917 are of value in predicting SVR in treated patients with chronic hepatitis caused by HCV genotype 4.
24096049 IL28B rs8099917 genotypes, HCV and HBV markers were determined in patients seropositive for HCV antibodies from uremic patients on hemodialysis. High HBsAg levels and favorable IL28B genotype were additively associated with spontaneous HCV seroclearance.
24085431 IL-28B rs12979860 C/T polymorphism is associated with hepatitis virus-related hepatocellular carcinoma and liver cirrhosis. [meta-analysis]
24081499 Studied the role of IL28-B polymorphism in the clearance of hepatitis C virus (HCV) in chronic hepatitis B virus (HBV)/HCV coinfection during a long-term follow-up.
24070114 genetic polymorphism is associated with serum protein levels but does not reflect the response to antiviral therapy
24057245 we observed that IL28B rs12979860 polymorphism was not related with severity of illness and also was not effective on treatment response.
24045339 This makes innate immune cells the key players in determining the functional significance of INFL3 polymorphisms in patients with hepatitis C
24039107 Unclear whether IL-28B polymorphisms constitute a risk factor for fibrosing cholestatic hepatitis in posttransplant hepatitis C.
24026885 Carriage of IL28B rs12979860 CC genotype was associated with an increased risk for developing liver cirrhosis among patients with HBV infection
23981065 The IL28B rs12979860 polymorphism is not associated with fibrosis and liver inflammation in Egyptian HCV G4.
23950709 This paper describes a link between Med23 and IFN-lambda3, provides evidence for the crucial role of IFN-lambda in HSV-1 immune control.
23936821 In HCV-1 IL28B CC patients, cirrhosis is the only clinical baseline predictor of PegIFN and Rbv treatment failure.
23936294 the association between IL28B polymorphism and steatosis in chronic HCV patients
23916907 IL28B CC polymorphism is associated with increased Th1 cytokine production of activated peripheral blood monocytes and lymphocytes, which may play a role in interferon-induced rapid immune control.
23908124 Female sex, favorable IL28B genotype, and HCV genotype 1 are independent predictors of spontaneous clearance of hepatitis C.
23880623 SNPs of the IL-28B gene at (rs12979860) CC genotype as well as the IL-10 gene SNPs at -819 (rs3021097)TT genotype can be used for predicting response to treatment before patients are prescribed the expensive pegylated interferon-alpha/ribavirin therapy.
23874902 SNP upstream of IL28B that has the strongest genetic association with HCV recovery has an inverse influence on HBV recovery
23860735 Genetic variation near interleukin 28B increases the risk of hepatocellular carcinoma in patients with chronic hepatitis C.
23859071 Donor PNPLA3 and IL28B genotypes are not associated with posttransplant obesity or diabetes, making peripheral rather than hepatic mechanisms associated with these genotypes more likely
23850879 Temperature rise after peginterferon alfa-2a injection in patients with chronic hepatitis C is associated with virological response and is modulated by IL28B genotype.
23829453 Baseline IL28B genotype and rapid virologic response can serve as early predictors for treatment success
23826153 the presence of host genetic risk factors, IL28B-T and KIR2DS3 alleles, resulted in increased odds of treatment failure in these rapid virological response negative patients.
23784926 Studied predictors of spontaneous disease resolution in a cohort of patients with acute hepatitis C (AHC), analyzing epidemiological, clinical and virological parameters together with IL28B.rs12979860 genotypes and cell-mediated immunity (CMI).
23782163 The rs12979860 CC variant upstream of IL28B gene is associated with spontaneous clearance of Hepatitis C virus(HCV) in Chinese blood donors and female donors are more likely to clear HCV infection than male donors.
23730840 In chronic chronic hepatitis C genotype 6 infection, IL28B polymorphisms were associated with response to therapy.
23722013 Donor and recipient rs12979860 alleles synergistically influence sustained virological response rate to antiviral treatment for recurrent hepatitis C.
23712427 Induction of IL28B and IFN-gamma-inducible protein 10 (IP-10) mRNA relies on TT/-G.
23703931 IL28B CC genotype was associated with greater hepatic necroinflammation, higher ALT, and worse clinical outcomes in chronic hepatitis C patients.
23689989 The IL28B minor allele was associated with lower inflammatory activity and less progressed fibrosis of the liver; however, it constituted a risk factor for younger-age onset of hepatocellular carcinoma in patients with chronic hepatitis C
23652058 IL-28 genotype was not associated with response to interferon treatment (OR for GT/GG vs. TT, 0.881 (95%CI 0.388 - 2.002); P = 0.762; OR for CT/CC vs. TT, 0.902 (95%CI 0.458 - 1.778); P = 0.766).
23647954 IL-28B genotype is significantly associated with sustained virologic response in Caucasian patients with HCV genotype 2/3 infection treated with pegIFN and ribavirin for 24 weeks.[meta-analysis]
23615070 Data indicate there was a link between baseline viral load, age (40 years), IL-28B (rs12979860), HDAC2 (rs3778216), HDAC3 (rs976552) and HDAC5 (rs368328) with sustained virological response (SVR).
23611115 IL28B rs12979860 and rs8099917 single nucleotide polymorphisms are significantly associated with spontaneous clearance of HCV infection.
23594959 Data indicate that CC-chemokine receptor 5 (CCR5) gene (CCR5-Delta32) does not influence treatment response of hepatitis C virus (HCV) infection in the context of IL28B polymorphisms.
23591768 Genetic variations around IL28B affect IFN-lambda3 production and so determine the outcomes of Peg-IFN/ribavirin treatment.
23587473 In patients with acute HCV hepatitis, lack of viral clearance may be predicted by absence of jaundice and IL28B CT/TT genotype; in patients with these characteristics, treatment needs to be started immediately.
23570849 In the title.
23564024 Genetic polymorphism of the IL-12B gene (rs6887695) may be associated with the psoriasis susceptibility in the Chinese Han population, especially for the plaque cases.
23532802 Review/Meta-analysis: IL28B polymorphism seems to influence the SVR rate in patients with chronic hepatitis C treated with triple therapy.
23522062 IL28B genotype can be incorporated with other variables into a prediction model to predict treatment outcome in hepatitis C.
23490371 The presence of a G allele in rs8099917, known to associate to a poor response to Peg-interferon/ribavirin therapy, predicts an increased association of hepatitis c virus RNA with peripheral mononuclear leukocytes.
23486666 IL28B polymorphisms are associated with a marked increase in viral load in hepatitis C virus subtype 3a.
23469142 HBV viral load and IL28B rs10853728 CC genotype correlated with hepatitis activity in HBeAg-positive and HBeAg-negative CHB, respectively
23455512 A rapid PCR-based test to screen for two IL28B SNPs.
23449268 IL28B haplotype block CG (rs12979860/rs8099917) was associated with HBsAg seroclearance.
23442843 It seems likely that a high sustained virological response in Korean patients with genotype 1 chronic hepatitis C is due to the genetic polymorphism in IL28B.
23440114 the IL28B genotype appears to be a strong predictor of sustained virological response following PEG-IFN/RBV therapy in treatment-naive Brazilian patients infected with HCV genotype 1.
23426277 The IL-28B genotype is associated with HCC recurrence, gene expression, and histologic findings in patients with CHC.
23420232 IL-28B and HLA class II are independently associated with spontaneous resolution of HCV infection, and SNPs marking IL-28B and DQB1*03:01 may explain approximately 15% of spontaneous resolution of HCV infection.
23382988 in contrast to donor IL28B genotype recipient IL28B was associated with graft survival and clinically relevant HCV recurrence in HCV infected recipients. No effect of IL28B genotype was manifest in non-HCV LT recipients.
23358556 In the Moroccan population, polymorphisms near the IL28B gene play a role both in spontaneous clearance and progression of HCV infection
23343781 No significant association was identified between polymorphisms near the IL28B gene and the natural courses of chronic HBV infection, including the HBV clearance and HCC occurrence.
23333445 IL28B and DDX58 single nucleotide polymorphisms that are favorable when present in the non-transplant setting or in the recipient are unfavorable when present in a donor liver graft.
23323251 The high prevalence of IL28B-CC type among Koreans, which may be a good predictor of Sustained virologic response.
23323000 In HCV-genotype 4 patients, rs12979860 is a sensitive predictor of viral clearance
23314745 In children and adolescents chronically infected with HCV genotypes 1 and 4, IL-28B rs12979860 and rs8099917 polymorphisms were the only predictors of response to peg-IFN/RBV.
23301835 IL28B genotype is not useful for predicting treatment outcome in Asian chronic hepatitis B patients treated with pegylated interferon-alpha.
23301546 IL-28B polymorphisms and ITPA variants influence outcome of treatment for chronic hepatitis C with Peg-Interferon and ribavirin.
23298311 IL28B polymorphisms influence both the outcome of interferon treatment and the natural clearance of HCV. However, a universal predictor SNP could not be identified, as the best genetic markers differed depending on patient ethnicity, genotype, and type of infection. [Meta-analysis]
23293195 In chronic HepC patients, the genotype rs12979860 was found as a predictor of sustained virological response to pegIFN/Ribavirin treatment. However, in HCV genotype 1 patients under 40 years old, the rs12979860 genotype lost its predicitive ability.
23266640 meta-analysis demonstrated that rs12979860CC and rs8099917TT contributed to the spontaneous clearance of hepatitis C virus infection in Caucasians
23259930 Study failed to support the previously reported positive association between the IL28B rs12979860 polymorphisms and an increased risk of developing HAM/TSP in the Brazilian population.
23237012 a sizable proportion of HCV carriers have detectable IFN levels that do not indicate a greater severity of disease or display any relationships to specific IL28B rs12979860 variants.
23227209 IL-28B rs12979860 C/T polymorphism T allele appears to be more prevalent in patients with hepatocellular carcinoma than in liver cancer.
23225905 We found that the IL28B CC genotype was independently associated with spontaneous HIV control.
23220171 In white patients with genotype 1 chronic hepatitis C, the IL28B rs12979860 CC genotype is associated with reduced insulin resistance.
23207147 IFN-lambdas can also directly affect T cells through inhibition of the T helper 2 cell (Th2) responses. IFN-lambdas have varying immunomodulatory functions under different physiological conditions
23197895 Report biosensor microarray assay for detecting Il28B rs8099917 and rs12979860 genotypes.
23196939 Baseline expression of Interferon-stimulated genes in PBMCs from HCV/HIV-coinfected patients influence the response to peginterferon/ribavirin therapy, regardless of IL28B genotypes.
23173032 genetic polymorphisms of IL28B had no impact on treatment responses in genotype-2 chronic hepatitis C patient
23164695 IL28B genotype influences serum tumor necrosis factor-alpha levels in chronic hepatitis C.
23159283 This paper investigates serum levels of IL-10 and IL-6 in patients with chronic hepatitis C genotype, the relation of each with clinical and virological characteristics and their relation with the IL28B polymorphisms rs12979860.
23151203 Data suggest that SNPs near IL28B/IFNL3 region (rs12979860; rs8099917) are associated with response of chronic hepatitis C patients to peginterferon-alfa/ribavirin treatment; response is strongest in patients with Hepacivirus genotypes 1/4. [REVIEW]
23149444 genetic association studies in population in Italy: Data suggest that 3 SNPs (IL28B, rs8099917; SLC28A2 rs11854484; CYP27B1, rs4646536) are associated with pharmacokinetics of ribavirin and thus, sustained virologic response in hepatitis C patients.
23147144 In this population, the analysis of a single SNP, rs12979860, successfully predicts sustained virological response in the IFN-ribavirin treatment of HCV.
23142377 IL-28B SNPs rs12979860 genotype CC and rs8099917 genotype TT were involved in sustained virological response in patients infected with chronic HCV genotype 1 to PEG-INF/RBV therapy.
23137758 The study revealed an association between the rs12979860 polymorphism of the IL-28 B gene with viral clearance in hepatitis C genotype 4.
23135762 There were significant differences in the reduction of HCV-RNA levels after peg-IFN-alpha plus ribavirin therapy based on the IL28B single nucleotide polymorphisms rs8099917 between TT (favourable) and TG/GG (unfavourable) genotypes in patients.
23133602 In HCV-HIV coinfected patients treated with PegIFNalpha and ribavirin, SVR is associated with IL28B rs8099917 polymorphism; HCV treatment-induced neutropenia and thrombocytopenia are associated with SOCS3 rs4969170 polymorphism
23121365 Although the protective rs12979860 IL28B CC genotype is associated with spontaneous hepatitis C virus clearance, stronger CD4(+) T-cell responses towards NS3 were only evident among those with non-CC haplotypes.
23121166 Insulin resistance predicts sustained virological response to treatment of chronic hepatitis C independently of the IL28b rs12979860 polymorphism.
23118858 Direct comparison of IP-10 and IL-28B polymorphism between chimpanzees and patients in relation to HCV infection, illustrates that the IFN-pathways are important during HCV infection in both species
23109451 A Mexican HCV-1-infected population treated with peg-IFNalpha and RVB had a low SVR rate, which was associated with the IL28B SNP rs12979860.
23107586 Recipient and donor Il28B CC genotype is associated with a better treatment response to interferon-based therapy after liver transplant.
23103287 IL28B polymorphisms are associated with severity of liver disease in human immunodeficiency virus (HIV) patients coinfected with hepatitis C virus.
23101227 In 79% of patients infected with genotype 1 ofHCV genotypes C/T or T/T have been found which is an adverse prognostic factor of the treatment.
23090351 In African-American and White HCV genotype 1 patients, ribavirin AUC0-7 thresholds were associated with WK24VR and SVR independently of IL28B SNP genotype.
23083820 This article reviews the discovery, biology, and potential clinical applications that have stemmed from the seminal observation that IL28B polymorphisms are a main predictor of HCV clearance.
23080496 Chronic hepatitis C patients with the IL28B polymorphism have a higher number of amino acid substitutions in the NS5A region and early viral evolution due to greater interferon induced selective pressure during this critical period of treatment.
23030669 Data suggest that interleukin 28B (IL-28B) rs12979860 (CT/TT) genotype could be mediating on the contrary a certain protective effect against the hepatic damage caused by this virus in patients coinfected by HIV.
23020144 IL-10-592-CC, IL-28-rs8099917-TT and IL-28-rs12979860-CC genotypes were significantly higher in responders than in non-responders
23008132 use IL-28B genotyping to reduce the impact of post- liver transplantation adverse outcomes.
23002361 IL28B variation is the strongest host factor not related to insulin resistance that determines outcome of antiviral therapy in chronic hepatitis c.
22986179 The G allele for IL-10 (-1082 A/G), the C allele for IL-4 (+3 C/T) and the C and T alleles for IL-28B (rs12979860 and rs8099917, respectively) are associated with spontaneous viral clearance in hepatitis C infection
22967712 IL-28B single-nucleotide polymorphisms are associated with graft re-infection after liver transplantation.
22966241 paper presents overview about the biological activity and clinical applications of IL28B, summarizing the available data on its impact on hepatitis C virus infection [review]
22964578 Patients with the IL28B rs12979860 CC genotype and a low pretreatment gamma-GT/ALT ratio achieved the highest rate of a SVR with the highest predictive values
22943900 IL-28B gene polymorphisms were correlated to the susceptibility to hepatocellular carcinoma in Chinese Han ethnic population. Among them, GA + GG genotype at rs4803223 could increase the risk of tumor thrombosis in portal vein in HCC patients.
22930497 study evaluates relationship of an IL28B polymorphism and HCV NS3 sequence diversity in HIV co-infected patients; results indicate there is no significant effect of rs12979860 IL28B polymorphism on baseline NS3 quasispecies diversity in co-infected subjects
22913807 patients who possess harbour the CC or TT genotypes were more likely to clear HCV infection spontaneously
22898703 IL28B single nucleotide polymorphism genotypes and cirrhosis were highly associated with sustained virological response.
22882858 Patients with the CC rs12979860 genotype had higher rates of SVR than those with the CT or TT genotype, and the CC genotype revealed a significantly higher level of IL-28 mRNA expression.
22790387 there is an increased risk of severe hepatitis C virus recurrence after liver transplantation in patients with a T allele of IL28B rs12979860
22766768 The IL28B genotype is predictive not only of sustained virological response (SVR) but also of the histologic diagnosis of posttransplant hepatitis C.
22762459 Interleukin-28B polymorphisms are associated with fibrosing cholestatic hepatitis in recurrent hepatitis C after liver transplantation.
22727259 Examined the lower efficacy of pegIFN/RBV in HCV-1a than HCV-1b; found the effect of IL28B variants on sustained virologic response was mainly recognized in HCV-1a.
22719902 HCV clearance in Egypt was associated with a region of IL28B smaller than that identified in European populations, and involved the non-synonymous IL28B SNP, rs8103142
22666430 The IL28B rs12979860 polymorphism correlates with the biochemical activity and the presence and severity of liver steatosis in chronic hepatitis
22649509 The rs12979860-CC variant upstream of IL28B gene is associated with spontaneous clearance of HCV, susceptible to IFN/RBV treatment and increased IL-28B levels in this Chinese population.
22641049 There is a strong association between common IL28B polymorphisms and the outcome of PEG-IFN-alpha plus ribavirin combination therapy in patients chronically infected with hepatitis c virus genotype 1.
22634340 Insulin resistance is more common in carriers of the T allele of single nucleotide polymorphism rs12979860 than in CC homozygotes.
22613000 For hepatitis C virus genotype 1, both IL28B and baseline Homeostasis Model Assessment of Insulin Resistance are independent pretreatment predictors of sustained virological response in patients treated with PegIFNa-2b and ribavirin.
22612303 IL-28B genotype and sustained viral clearance in HCV genotype 1 patients
22591106 IL28B polymorphisms predict sustained viral response in HCV patients
22577043 Viral responses were also significantly correlated with single nucleotide polymorphism in IL28B.
22555162 High-HCV viral load, HCV genotype 3 and IL28B genotype CC had a significant influence on the risk of all-cause mortality among individuals coinfected with HIV-1. This may have consequences for the management of HIV-HCV-coinfected individuals.
22545770 The IL28B genotype frequencies were 41.7% (n=202) for CC, 46.5% (n=225) for CT, and 11.7% (n=57) for TT patients, thus IL28B rs12979860 genotypes influence mortality risk in HIV-infected, antiretroviral-treated patients.
22543885 associated with hepatic steatosis prevalence and severity in Caucasians with genotype 1 chronic hepatitis C infection
22530607 PNPLA3 p.148M/M genotype was negatively associated with sustained virological response and an association between IL28B CC genotype and more severe liver fibrosis.
22525303 SNPs in chromosome 19, in the region of the IL28B gene , are strongly associated with the probability of achieving SVR with PegIFN and RBV treatment in genotype 1-infected patients (36,37
22521356 probability of developing chronic hepatitis C was lower for immediate treatment initiation than for delayed initiation regardless of the presence of symptoms or IL28B genotype
22511448 IL28B variation is likely to influence natural clearance of hepatitis C [review]
22509814 C-allele frequency of the IL28B gene SNP rs12979860 in Morocco is higher than in the African populations. Distribution of this SNP distinguishes in a population of CHC between SVR and nonresponders
22505587 In patients with Genotype 1 chronic hepatitis C, IL28B polymorphisms are associated with the likelihood to achieve rapid virological response and sustained virological response.
22497812 IL28B polymorphisms were the only common genetic variants associated with pretreatment Low-density lipoprotein cholesterol (LDL-C) level in Caucasians (rs12980275, P = 4.7 x 10(-17), poor response IL28B variants associated with lower LDL-C).
22495472 hepatitis C virus etiology in association with the carriage of IL-28B T/T genotype predicted the highest frequency of acute cellular rejection.
22473858 IL28B polymorphism is an additional predictor of off-therapy IFN-related HBsAg seroclearance to be used in the pretreatment stratification of HBeAg-negative patients chronically infected by genotype D of HBV.
22460962 Studied IL28B polymorphisms in individuals with HTLV-1. Alleles CT/TT were more frequent in HTLV-1-associated myelopathy/tropical spastic paraparesis than in asymptomatic carriers, and median HTLV-1 proviral load was greater in CT/TT than CC carriers.
22431022 interaction between IL-28B rs12979860 T/T genotype and low serum cholesterol concentration is an independent predictor of a worse disease course among patients infected with HCV with normal or near-normal transaminases
22411462 IL28B polymorphism may be regarded as a genetic risk factor for HCV-related carcinogenesis, posttransplant fibrosis progression, and antiviral therapy failure.
22374338 These results indicate that IL28B rs12979860 single nucleotide polymorphism increased the risk of hospitalization for bronchiolitis at early age.
22350701 IL28B genotypes were significantly associated with both vesicular and clear cell changes of livers in chronic hepatitis C patients.
22336134 HTLV-1 mono-infection up-regulates the expression of IL-28B transcripts in genotype-dependent manner, whiles HTLV-1/HCV co-infection down-regulates regardless of ATL development.
22329371 IL28B gene variants were significantly associated with the spontaneous clearance of HCV infection in Chinese patients. Women were more likely to clear HCV infection regardless of IL28B genotypes.
22328925 Results demonstrate that rs12979860, compared to rs8099917, may be a better predictor of response to the peg-IFN/RBV treatment among HCV/HIV-1 coinfected patients.
22325058 No association was found between IL-18 gene and IL-28B gene polymorphisms with HBV recurrence in the liver transplant recipients or the donors.
22324878 interleukin-28B (IL-28B) genotype does not seem to have a role in the development of chronic hepatitis B among HIV-infected patients
22314430 In non-alcoholic fatty liver disease patients, IL28B rs12979860 CC genotype, together with PNPLA3 rs738409 GG, is associated with the severity of liver damage.
22313623 IL28B CC genotype patients with chronic hepatitis C show a sustained treatment-induced gene expression profile which is not seen in non-CC genotype patients.
22310928 IL28B rs12979860 C/T polymorphism might affect susceptibility to the chronic HBV infection and progression of HCC. The T allele and non-CC genotypes have strong predictive effect of increasing susceptibility of chronic HBV infection and HCC.
22300408 IL28B polymorphisms are strongly associated with with posttransplant diabetes mellitus.
22298465 Hepatitis C viremia at week 2 and a non-C/C recipient IL-28B genotype were independent risk factors for cholestatic recurrence after liver transplantation.
22295096 the association of carriage of the T allele of the tagging single nucleotide polymorphism rs12979860 3 kb upstream of IL28B and allergy in children
22285807 IL28B genotype was strongly associated with cell-type specific staining for myxovirus A protein 1
22277049 relationship between IL-28B SNPs and susceptibility to schizophrenia
22263608 In a cohort of 95 chronic hepatitis B patients, who were treated with peg-interferon and adefovir for 1 year, and who had 15% HBsAg loss (overall), no association was found between IL28B polymorphisms and HBeAg seroconversion or HBsAg clearance.
22257210 rs8099917 IL28B polymorphism is not a risk factor for predisposition to nonalcoholic fatty liver disease in a sample of Iranian population.
22253847 This study aimed to 1) examine DNA sequences in IL28B surrounding each of the reported associated single nucleotide polymorphisms and the corresponding regions in IL28A.
22253715 This study shows that the CC(rs12979860) single nucleotide polymorphism is associated with more pronounced liver histopathology in patients chronically infected with hepatitis c virus genotype 3.
22248659 IL28B genotype appears to affect early viral kinetics in patients with chronic hepatitis C receiving interferon-free treatment.
22247028 genome-wide association identified several single nucleotide polymorphisms near the IL-28 gene, associated with virological response to therapy of chronic hepatitis c
22245236 gene polymorphism does not directly influence hepatocarcinogenesis in Japanese patients with chronic HCV infection
22239156 The polymorphism had no association with clearance of hepatitis B surface antigen and hepatitis B e antigen, HBV-DNA level, apparent hepatitis onset and liver cirrhosis
22234924 Treatment outcome prediction could not be improved in homozygous carriers of the IL28B rs12979860 C responder allele by the additional determination of the rs8099917 SNP
22200702 The rs8099917 SNP in IL28B is probably associated with the response to interferon treatment in HBeAg-positive patients with chronic hepatitis B, and Allele G may be predictive of the treatment success.
22193282 Rs8099917 TT interleukin-28B genotype is significantly independently predictive of on-treatment virological responses, which were the major determinants of an SVR, in Asian HCV-1 patients.
22192885 Combination of serum level of IP-10 and SNPs in IL28B can identify patients with acute hepatitis C who are most likely to undergo spontaneous clearance.
22189977 IL28B is a gene on chromosome 19, coding for interferon-lambda3, and 2 polymorphisms upstream of this gene have been strongly associated with outcome after treatment for hepatitis C; IL28B polymorphisms have been associated with spontaneous clearance [review]
22180419 IL28B polymorphisms influence stage of fibrosis and spontaneous or interferon-induced viral clearance in thalassemia patients with hepatitis C virus infection.
22180014 In chronic hepatitis C, IL28B variants associated with poor response to interferon therapy may predict slower fibrosis progression, especially in patients infected with non-1 HCV genotypes.
22174846 IL28B and STAT1-nuclear translocation in hepatocytes are independent predictors of response to treatment with peginterferon and ribavirin in chronic hepatitis C patients.
22168813 A set of polymorphisms in the region of the interleukin-28B (IL-28B) gene on chromosome 19, coding for interferon (IFN)-lambda3 were associated with clearance of genotype 1 hepatitis C virus (HCV) in patients treated with PEG-IFN-alpha and RBV.
22156487 The rs8099917 genotype and total PEG-IFN dose were associated with sustained virological response in patients with hepatitis C virus genotype 1.
22155912 IL28B CC-genotype association with HLA-DQB1*0301 allele is protective against hepatitis C virus infection in a cohort of thalassemic patients.
22117591 A polymorphism near the IL28B gene has been shown to be associated with virologic response to antiviral treatment in HCV-infected patients.
22110669 a possible synergistic interaction between female sex and IL28B in spontaneous clearance of HCV
22108195 Polymorphisms near IL28B are independently associated with serologic response to PEG-IFN in patients with HBeAg-positive chronic hepatitis B.
22098416 IL28B polymorphisms are markers of therapy response and are influenced by genetic ancestry in chronic hepatitis C patients from an admixed population.
22096924 The authors discovered that polymorphism of IL28B was responsible for the efficacy of PEG-IFN/RBV therapy and subsequent elimination of HCV.
22052088 The sustained virological response (SVR) rate was 45.9% in patients with the IL-28B major allele, but 13.3% in patients with the IL-28B minor allele.
22046316 the dinucleotide repeat could be associated with the transcriptional activity of IL-28B as well as being a marker to improve the prediction of the response to interferon-based hepatitis C virus treatment.
22027585 Single nucleotide polymorphism rs12979860 is strongly associated with both phase 1 and phase 2 hepatitis C RNA kinetics in African Americans and caucasians with HCV genotype 1.
22013224 study evaluated genetic models for the association of IL28B genotype (rs12979860 and rs8099917) with hepatitis C virus clearance; a supra-additive (quadratic) model fit these data best
21987611 Data show that the three IL28B polymorphisms studied are strongly associated with sustained virological response to therapy in Chilean patients with chronic HCV (genotype 1).
21983945 These results provide novel insights into the associations of natural killer phenotype with IL-28B genotype and gene expression patterns, as well as the role of NKs in mediating IFN-induced viral clearance of chronic HCV infection.
21974859 This study clearly shows an association between first-phase viral load decrease and the IL28B rs12979860 polymorphism in chronic HCV-infected patients treated with peginterferon alfa-2b/ribavirin.
21951981 The SNP rs12979860 is strongly associated with viral response in patients infected with HCV-4, but not with liver disease severity.
21933876 study demonstrates that the rs12979860 IL28B SNP has an important role in spontaneous clearance of principally hepatitis C virus genotype 4 infections in an Egyptian population
21932415 The IL28B rs12979860 single nucleotide polymorphism may have an added value in the treatment algorithm of hepatitis C virus - genotype 4 patients because it is the strongest predictor of an sustained virologic response to peg-interferon/ribavirin therapy.
21931540 Carriage of variants of either IL28B SNP was associated with absence of treatment-induced viral clearance and absence of spontaneous clearance in chronic hepatitis C.
21911885 IL28B host genotypes should be added to baseline predictors of response to PEG-IFN/ribavirin therapy in Latin American patients with European ancestry.
21905441 Variations in the IL28B gene have been linked to better response rate for people with chronic HCV infection treated with pegylated interferon, ribavirin and bociprevir.
21900787 This study confirms that SNPs rs8099917 and rs12979860 used alone may be useful for predicting the outcome of HCV treatment.
21898478 Gene expression involving innate immunity is strongly associated with IL28B genotype and response to PEG-IFNalpha/ribivirin.
21889215 A role of IL28B polymorphisms is not supported in the response to IFNbeta in multiple sclerosis patients.
21884517 The IL28B CC genotype does not account for the noted HIV control.
21879313 amino acid 70 substitution in the core region of hepatitis C virus and the rs8099917 single nucleotide polymorphism located proximal to interleukin 28B were independent factors in determining serum apoB-100 and low-density lipoprotein cholesterol
21876443 Low-density lipoprotein receptors and IL-28B genotypes had a complementary effect with respect to the plasma levels of total cholesterol and low-density lipoproteins, with no influence on plasma levels of high-density lipoproteins and triglycerides.
21861668 The IL28B variants are also associated with likelihood of spontaneous clearance of HCV infection.
21861317 Polymorphisms in the region of the interleukin-28B (IL28B) gene have recently been associated with spontaneous and treatment induced clearance of hepatitis C virus infection.
21813376 the T allele of the rs12979860 polymorphism of the IL28B gene has a role in progression of liver fibrosis in HIV/HCV genotype 1 co-infected patients
21800339 Hepatitis C virus infection is capable of inducing antiviral cytokines and pathways in primary liver cell cultures; induction of IFN-stimulated genes and lambda IFNs may limit the growth and spread of HCV in primary cell cultures and in the infected liver
21790472 Association between the SNP rs12979860 of the IL28B gene and spontaneous clearance of HCV infection in a Brazilian HIV-1 population.
21760886 A clinical prediction model based on IL28B genotype and clinical variables can yield useful individualized predictions of the probability of treatment success.
21750736 Data show thatin chronic hepatitis C patients, IL28B polymorphism was associated with serum levels of corticosteroid binding globulin, a major transporter of cortisol.
21745312 IL28B SNPs and mutations in the core region and NS5A region of hepatitis C virus are associated with peginterferon responsiveness in chronic hepatitis C.
21745278 Variability at the IL28B locus is associated with HBV viral load and hepatic inflammation. Genetic variation of IL28B may prevent HBV progression by reducing viral load and liver inflammation.
21739451 polymorphisms within the IL28 locus appear to be associated with differences in interferon stimulated gene expression levels.
21722179 The rs12979860 SNP strongly predicts therapeutic response in chronic hepatitis C virus genotype 1 patients.
21721028 In HCV patients with a known date of infection, IL28B genotype was not associated with fibrosis progression rate or with the risk of developing advanced liver fibrosis.
21703201 Both IL28B rs1297860 and CCR5Delta32 allelic variants are independent genetic determinants of spontaneous HCV clearance.
21703198 IL28B rs12979860 CC genotype is associated with less pronounced disturbances of lipid metabolism, as reflected both in serum lipoprotein levels and hepatic steatosis, in HCV infection.
21692944 IL28B polymorphisms influence the antiviral efficiency of interferon/ribavirin therapy and has a strong impact on SVR, independently of traditional response predictors.
21674555 the primary role for IL-28B in the resolution of hepatitis C virus infection
21670772 the HLA-DQB1 * 0301 allele and the IL28B rs12979860 genotype are significant independent predictors of response to pegIFN / RBV treatment in patients with chronic HCV infection.
21647799 genetic polymorphism is associated with the severity of liver fibrosis in chronic hepatitis C patients
21618576 data suggest that hepatitis C virus replication levels and response to interferon are affected by human hepatocyte IL28B single-nucleotide polymorphism genotype and mutations in the interferon sensitivity determining region
21615377 IL28B genotype seems to play a role in natural clearance of hepatitis C virus-RNA
21612542 The individuals with CC genotype of interleukin 28B have higher probability of clearing hepatitis c than those with TC or TT genotype.
21606533 IL28B gene testing may identify patients carrying genotype 2 or 3 who could benefit from extended treatment.
21600205 Propose that KIR2DL3:HLA-C1 and IL28B define 2 genetically distinct subpopulations of individuals who are relatively protected against chronic HCV infection.
21592993 The IL28B rs12979860 CC genotype is associated with a higher prevalence of cirrhosis in HIV-HCV-coinfected patients than CT/TT genotypes, suggesting that IL28B CC carriers may experience a more rapid progression of HCV-related liver fibrosis.
21501223 The IL28B genotype may help identify non-responding patients in HCV genotype 1, but not in HCV genotype 2 in Asian patients.
21480318 Vitamin D serum levels are complementary to the IL-28B rs12979860 C/T polymorphism in enhancing the correct prediction of the SVR in treatment-naive chronic hepatitis C.
21479134 rs12979860 is the ideal IL28B single nucleotide polymorphism for genetic testing in treating patients of genotype-1 hepatitis C virus chronic infection.
21466653 recipient IL28B genotype has a major role in the response to antiviral treatment for hepatitis C recurrence
21447862 genetic variation in IL28B is associated with hepatitis C treatment-induced viral clearance in the Chinese Han population.
21439960 High-dose pegylated IFN-alpha with standard or high doses of ribavirin induces a potent antiviral response in a substantial number of patients who did not respond to standard therapy. The IL-28B genotype is an independent predictor of the antiviral response.
21413051 IL28B plays no role in vertical transmission of hepatitis C virus, but IL28B CC child polymorphism is associated independently with the spontaneous clearance of HCV genotype-1 among infected children
21402922 The IL28B "T" allele was significantly increased in chronic hepatitis C virus infected patients.
21390311 Concomitant assessment of pretreatment IP-10 and IL28B-related SNPs augments the prediction of the first phase decline in HCV RNA, RVR, and final therapeutic outcome.
21384511 IL28b G-allele might serve as a marker for graft inflammation and as a predictor for unfavorable antiviral therapy outcome in HCV-re-infected liver transplant-population.
21382156 IL28b single nucleotide polymorphism predicts spontaneous viral clearance and sustained virological response in Hepatitis C.
21378537 study found HIV/HCV-co-infected patients with the IL28B C allele (CC/CT) at rs12979860 show significantly higher plasma HCV-RNA load than TT carriers
21374656 Polymorphisms near the IL28B gene show association with rapid viral response but not sustained viral response to PEG-IFN/ribavirin therapy in HCV genotype 3-infected patients.
21360716 We identified IL-28B haplotypes highly predictive of spontaneous HCV clearance
21354446 Thus, these findings provide compelling evidence for a major role of single nucleotide polymorphisms in proximity of IL28B in predicting the eradication of hepatitis C virus infection following therapeutic intervention.
21325786 This study identified genetic variation near IL28B gene and amino acid substitution of the hepatitis C virus core region as predictors of viral dynamics during triple therapy.
21257738 Effects of the IL28B single-nucleotide polymorphism may differ in HIV-infected patients with chronic and acute hepatitis C.
21254188 both the IL-28B variants and viral genotypes predicting a sustained virological response and the factors predicting an unsustained virological response were found together more often than expected.
21254179 Recipient IL28B TT genotype is associated with more severe histological recurrence of HCV. Recipient and donor liver IL28B genotype are strongly and independently associated with IFN-based treatment response in patients after liver transplantation.
21254158 When IL28B genotype is combined with pretreatment serum IP-10 measurement, the predictive value for discrimination between sustained virological response and nonresponse is significantly improved, especially in non-CC genotypes.
21254157 The rs8099917 TT genotype is significantly independently predictive of rapid virological response, which is the single best predictor of sustained virological response, in Asian HCV-2 patients.
21147186 evidence for a dominant, but not exclusive impact of the donor rather than the recipient IL28B genetic background on the natural course and treatment outcome of HCV liver graft reinfection
21146242 IL-28B rs12979860 C/T polymorphism T allele is more prevalent in patients with viral cirrhosis due to HCV in comparison to other aetiologies and to patients with mild chronic hepatitis C.
21145813 In general IL-29 serum levels exceeded IL-28A/B at least twofold, with IL-29 and IL-28A/B levels being significantly higher in carriers of the rs12979860 C allele than in TT homozygous individuals in hepatitis C
21145800 Among chronic HCV patients treated with peg-interferon plus ribavirin therapy, liver mRNA levels of IL28B, MxA, PKR, OAS1, and ISG15 were significantly or marginally lower in responders who became negative for HCV RNA.
21133812 IL28B polymorphism is associated with both side effects and clearance of hepatitis C during interferon-alpha therapy.
21129805 The IL28B polymorphism and mutations in the IFN sensitivity determining region of HCV were significant pre-treatment predictors of response to PEG-IFN/RBV.
21112660 The favorable IL28B SNP rs8099917 genotype is associated with a steep decline in viral load by the second week of chronic hepatitis C treatment.
21112657 The IL28B SNP rs12979860 CC genotype, lower age, and HCV genotype 2 were significantly associated with sustained virological response in HCV genotype 2/3-infected patients.
21111740 IL28B genotype and hepatic expression of interferon stimulated genes are independent predictors of response to treatment with pegIFN-alpha and ribavirin in patients with chronic hepatitis C.
21080244 IL-28 polymorphisms are associated with sustained virologic response and with natural viral clearance in hepatitis C
21070502 These findings suggest that IL28B may account for some differences in hepatitis C outcome but that other factors including the viral genotype, host genetics and the host-virus interaction are likely to influence the outcome of infection.
21070502 Observational study of gene-disease association. (HuGE Navigator)
21068134 IL28B polymorphisms and HCV core amino acid 70 substitutions contribute independently to an SVR to peg-interferon plus ribavirin combination therapy.
21068134 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
21048934 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
21038423 28B genotype is more frequent in individuals who have cleared an acute hepatitis C infection.
20977343 The C/C genotype of rs12979860 was not associated with HBV recovery, resistance to HIV infection, or HIV disease progression. This IL28B single-nucleotide polymorphism affects the immune response to HCV but not to HBV or HIV
20977343 Observational study of gene-disease association. (HuGE Navigator)
20964522 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20950615 association between IL28B and hepatitis C virus clearance
20931559 good response IL28B variant was strongly associated with lower level interferon-stimulated gene (ISG) expression. results suggest that IL28B genotype may explain the relationship between hepatic ISG expression and HCV treatment outcome.
20931559 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20924369 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20890887 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20889274 Observational study of gene-disease association. (HuGE Navigator)
20887330 Observational study of genetic testing. (HuGE Navigator)
20804372 IL28B gene variations independently predict sustained virologic response in human immunodeficiency virus/hepatitis C virus-coinfected patients with hepatitis C virus genotype 1 and non-genotype 1 hepatitis C virus infection.
20804372 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20803561 During recent hepatitis C virus infection, genetic variations in IL28B region were associated with spontaneous but not treatment-induced clearance. Early therapeutic intervention could be recommended for individuals with unfavorable IL28B genotypes.
20803561 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20728570 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20723035 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20708617 In patients with recurrent HCV infection after orthotopic liver transplantation, combination analyses of single nucleotide polymorphisms of IL28B in recipient and donor tissues and mutations in HCV RNA allow prediction of SVR to PEG-IFN/RBV therapy.
20708617 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20659305 Observational study of genetic testing. (HuGE Navigator)
20648473 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20637200 The SNP rs12979860 upstream of IL28B is associated with spontaneous clearance of HCV. Women with the C/T or T/T genotype who did not develop jaundice had a lower chance of spontaneous clearance of HCV infection.
20637200 Observational study of gene-disease association. (HuGE Navigator)
20621700 An IL-28B polymorphism was associated with an sustained viral response in patients infected with genotype 2/3 HCV who did not achieve a rapid viral response.
20621700 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20578254 different rates of viral genotype infection depending on the IL28B variant as well as an association of this locus with natural and treatment-mediated response were found.
20578254 Observational study of gene-disease association. (HuGE Navigator)
20576307 the proportion of HCV wild type core amino acids 70 and 91 was significantly greater (p=1.21 x 10(-4) and 0.034) and levels of gamma-GTP significantly lower (p=0.001) in patients homozygous for the IL28 major allele
20455677 a close association of IL-28B SNPs with treatment response of hepatitis C.
20434452 The expression of hepatic interferon-stimulated genes is strongly associated with treatment response and genetic variation of IL28B in chronic hepatitis C.
20434452 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20399780 Interleukin-28B polymorphism improves viral kinetics and is the strongest pretreatment predictor of sustained virologic response in genotype 1 hepatitis C virus.
20399780 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20389235 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20346265 Interferon-alpha treatment in patients with hepatitis C affect gene expression regulation in interferon lambda3 expression.
20235331 Chronic hepatitis C patients with the rs12979860 CC responder genotype may have a lower endogenous IFN response to the virus.
20176026 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20060832 The association of the IL28B locus with natural and treatment-associated control of HCV indicates the importance of innate immunity and interferon lambda in the pathogenesis of HCV infection.
20060832 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19759533 Observational study of gene-disease association. (HuGE Navigator)
19759533 primary role for IL28B in resolution of HCV infection
19749758 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19749757 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19684573 Observational study and genome-wide association study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19457860 The crystal structure of human IFN-lambda3 was determined and the interaction with its receptor complex through structure-based site-directed mutagenesis, was characterized.
19304895 recent findings about the biology of IFN-lambdas and their pathophysiological roles in viral infection, cancer, and immune responses of the innate and adaptive arms.[review]
18987645 Human interferon-lambda3 is a potent member of the type III interferon family.
16478884 IFN-lambdas are thus able to generate tolerogenic DCs, an activity that could thwart IFN-beta functions
12483210 closely positioned genes on human chromosome 19 encode distinct but paralogous proteins, which we designate interferon-lambda1 (IFN-lambda1), IFN-lambda2 and IFN-lambda3
12469119 identified from the human genomic sequence a family of three cytokines, designated interleukin 28A (IL-28A), IL-28B and IL-29, that are distantly related to type I interferons (IFNs) and the IL-10 family

AA Sequence

MTGDCMPVLVLMAAVLTVTGAVPVARLRGALPDARGCHIAQFKSLSPQELQAFKRAKDALEESLLLKDCK      1 - 70
CRSRLFPRTWDLRQLQVRERPVALEAELALTLKVLEATADTDPALGDVLDQPLHTLHHILSQLRACIQPQ     71 - 140
PTAGPRTRGRLHHWLHRLQEAPKKESPGCLEASVTFNLFRLLTRDLNCVASGDLCV                  141 - 196
//

Text Mined References (459)

PMID Year Title
27522730 2016 [PROGNOSTIC VALUE OF THE COMBINATION OF BLOOD GROUP SPECIFICITY AND INTERLEUKIN 28B GENE POLYMORPHISM FOR ESTIMATION OF EFFICIENCY OF THERAPY WITH THE USE OF PEGYLATED INTERFERON ?-2 AND RIBAVARIN IN PATIENTS WITH CHRONIC GENOTYPE 1 HEPATITIS C].
27156332 2016 Correlation Study Between IL-28B Gene Polymorphism (rs8099917SNP) and Sustained Virological Response in Iranian Patients with Chronic Hepatitis C.
27100663 2016 Pretreatment Predictors of Response to PegIFN-RBV Therapy in Egyptian Patients with HCV Genotype 4.
27058339 2016 [Effect of IL-28B polymorphisms on the natural course of HBV infection].
26911666 2016 Integrative role of vitamin D related and Interleukin-28B genes polymorphism in predicting treatment outcomes of Chronic Hepatitis C.
26896692 2016 Cellular Mechanism for Impaired Hepatitis C Virus Clearance by Interferon Associated with IFNL3 Gene Polymorphisms Relates to Intrahepatic Interferon-? Expression.
26741362 2016 Association with Spontaneous Hepatitis C Viral Clearance and Genetic Differentiation of IL28B/IFNL4 Haplotypes in Populations from Mexico.
26732192 Evaluation of factors associated with relapse in telaprevir-based triple therapy for chronic hepatitis C.
26699619 2015 Performance and Value of IFN-Lambda3 and IFN-Lambda4 Genotyping in Patients with Chronic Hepatitis C (CHC) Genotype 2/3 in a Real World Setting.
26670100 2015 Impact of IL28B, APOH and ITPA Polymorphisms on Efficacy and Safety of TVR- or BOC-Based Triple Therapy in Treatment-Experienced HCV-1 Patients with Compensated Cirrhosis from the ANRS CO20-CUPIC Study.
26660164 2016 Association of IL28B rs8099917 genotype and female sex with spontaneous clearance of hepatitis C virus infection: a Japanese cross-sectional study.
26614853 2015 Genetic predictors of the response to the treatment of hepatitis C virus infection.
26609200 2015 HTLV-1-Associated Myelopathy/Tropical Spastic Paraparesis Is Not Associated with SNP rs12979860 of the IL-28B Gene.
26606750 2015 Hepatic Interferon-?3 (IFNL3) Gene Expression Reveals Not to Be Attenuated in Non-Favorable IFNL3 rs4803217 or IFNL4 rs368234815 Minor Allele Carriers in Chronic Hepatitis C.
26602024 2015 Polymorphisms near the IFNL3 Gene Associated with HCV RNA Spontaneous Clearance and Hepatocellular Carcinoma Risk.
26599080 2015 The Impact of PNPLA3 rs738409 SNP on Liver Fibrosis Progression, Portal Hypertension and Hepatic Steatosis in HIV/HCV Coinfection.
26546777 2016 IL28B gene polymorphisms and Th1/Th2 cytokine levels might be associated with HTLV-associated arthropathy.
26526510 Epstein-Barr virus and Interleukin-28B polymorphism in the prediction of response to interferon therapy in hepatitis C patients.
26485009 2015 Genetic polymorphisms of IL28b gene as predictors of response to dual therapy in genotypes 1 and 4-HCV and HIV/HCV-infected patients.
26400298 2015 Association of polymorphism within the interleukin-28 receptor alpha gene, but not in interleukin-28B, with lower urinary tract symptoms (LUTS) in Chinese.
26394672 2015 Association of Single-Nucleotide Polymorphisms in IL28B, but Not TNF-?, With Severity of Disease Caused by Andes Virus.
26378651 2015 Polymorphisms in EGFR and IL28B are associated with spontaneous clearance in an HCV-infected Iranian population.
26352693 2015 Genetic Polymorphisms of IL28B and PNPLA3 Are Predictive for HCV Related Rapid Fibrosis Progression and Identify Patients Who Require Urgent Antiviral Treatment with New Regimens.
26339796 2015 Association between CXCL10 and DPP4 Gene Polymorphisms and a Complementary Role for Unfavorable IL28B Genotype in Prediction of Treatment Response in Thai Patients with Chronic Hepatitis C Virus Infection.
26281194 2015 [Impact of interleukin-10 and interleukin-28 gene polymorphisms on the development and course of lupus nephritis].
26280154 2016 Polymorphisms at IL28B gene as predictors of viral relapse in genotype 4 Egyptian hepatitis C patients.
26269684 2015 Interferon-? polymorphisms and response to pegylated interferon in Iranian hepatitis C patients.
26259026 2016 TM6SF2 rs58542926 is not associated with steatosis and fibrosis in large cohort of patients with genotype 1 chronic hepatitis C.
26194286 2015 Guarding the frontiers: the biology of type III interferons.
26177560 2015 Interleukin- 28B: a prognostic marker in interferon based therapy of chronic HCV patients of the Pakistan with variable treatment response.
26156685 2015 Single nucleotide polymorphisms near IL28B gene and response to treatment of chronic hepatitis C in hemodialysis patients.
26150150 2015 Interferon ? 3 and 4 Genotyping Using High-Resolution Melt Curve Analysis Suitable for Multiple Clinical Sample Types.
26115445 2015 Association of IFNL3 and IFNL4 polymorphisms with liver-related mortality in a multiracial cohort of HIV/HCV-coinfected women.
26109548 2015 IFNL3 genotype is associated with differential induction of IFNL3 in primary human hepatocytes.
26079279 2015 HCV F protein amplifies the predictions of IL-28B and CTLA-4 polymorphisms about the susceptibility and outcomes of HCV infection in Southeast China.
26060059 2015 Role of IL28B genotyping in patients with hepatitis C virus-associated mixed cryoglobulinemia and response to PEG-IFN and ribavirin treatment.
26034208 2015 Altered effector functions of NK cells in chronic hepatitis C are associated with IFNL3 polymorphism.
26022419 2015 Doubtful Role of IL28B Polymorphism in Occult Hepatitis B Infection.
26021070 2015 [Evaluation of the antiviral therapy for chronic hepatitis C in patients unresponsive to previous treatment with regard to the interleukin-28B genotypes].
25971683 2015 Differential distribution of IL28B.rs12979860 single-nucleotide polymorphism among Egyptian healthcare workers with and without a hepatitis C virus-specific cellular immune response.
25970604 2015 IFN-? gene polymorphisms as predictive factors in chronic hepatitis C treatment-naive patients without access to protease inhibitors.
25962810 2015 A meta-analysis of the association between IL28B polymorphisms and infection susceptibility of hepatitis B virus in Asian population.
25958342 2015 The complete title: The effect of interleukin-28B rs12979860 polymorphism on the therapeutic response of Moroccan patients with chronic hepatitis C.
25938745 2015 IL28B polymorphisms of both recipient and donor cooperate to influence IFN treatment response in HCV recurrence after liver transplantation, but IL28B SNPs of the recipient play a major role in IFN-induced blocking of HCV replication.
25936570 2015 Potential genetic markers for prediction of treatment response in Egyptian children infected with HCV genotype 4.
25918016 2016 Interleukin 28B polymorphisms as predictors of sustained virological response in chronic hepatitis C: systematic review and meta-analysis.
25864220 IFNL3 polymorphisms and HCV infection in patients with beta thalassemia.
25857516 2015 Relationship between IL28B gene rs8099917 polymorphism and SVR in Turkish patients with hepatitis C virus genotype 1.
25852288 2015 Interferon-?-related genes and therapeutic response in Chinese hepatitis C patients.
25852275 2015 Interferon-?3 polymorphisms in pegylated-interferon-? plus ribavirin therapy for genotype-2 chronic hepatitis C.
25837166 2015 IL28B is associated with outcomes of chronic HBV infection.
25835418 2015 Variants in Antiviral Genes are Risk Factors for Cognitive Decline and Dementia.
25818002 2015 Association between IL28B polymorphism, TNF? and biomarkers of insulin resistance in chronic hepatitis C-related insulin resistance.
25811035 2015 Correlation between genetic variations and serum level of interleukin 28B with virus genotypes and disease progression in chronic hepatitis C virus infection.
25788203 2015 Influence of IFNL3.rs12979860 and IFNL4.ss469415590 polymorphism on clearance of hepatitis C virus infection among Egyptians.
25773845 2015 Evaluation of the frequency of the IL-28 polymorphism (rs8099917) in patients with chronic hepatitis C using Zip nucleic acid probes, Kerman, Southeast of Iran.
25773839 2015 High resolution melting curve assay for detecting rs12979860 IL28B polymorphisms involved in response of Iranian patients to chronic hepatitis C treatment.
25769643 2015 IL28B rs12980275 variant as a predictor of sustained virologic response to pegylated-interferon and ribavirin in chronic hepatitis C patients: A systematic review and meta-analysis.
25747035 2015 Genetic variations of IL-28B and PD-1 are in association with the susceptibility and outcomes of HCV infection in Southeast China.
25743001 2015 Safety and efficacy of partial splenic embolization in telaprevir-based triple therapy for chronic hepatitis C.
25735432 2015 A thymine-adenine dinucleotide repeat polymorphism near IL28B is associated with spontaneous clearance of hepatitis C virus.
25712648 2015 IL28B polymorphism (rs12979860) associated with clearance of HCV infection in Poland: systematic review of its prevalence in chronic hepatitis C patients and general population frequency.
25708904 2015 The genotype CC of IL-28B?SNP rs12979860 is significantly associated with a sustained virological response in chronic HCV-infected Pakistani patients.
25687192 2015 Baseline factors associated with treatment response in patients infected with hepatitis C virus 1b by stratification of IL28B polymorphisms.
25675103 2015 IFNL4 and IFNL3 associated polymorphisms strongly influence the spontaneous IFN-alpha receptor-1 expression in HCV-infected patients.
25668821 2015 Interferon lambda-3 polymorphism and response to pegylated interferon in patients with hepatitis D.
25664396 2015 Gene polymorphisms of interleukin 28B and the risk to chronic hepatitis B virus infection in Thai.
25663241 2015 Genetic Variants in Interleukin-28B Are Associated with Diabetes and Diabetes-Related Complications in Patients with Chronic Hepatitis C Virus Infection.
25611696 2015 Impaired induction of interleukin 28B and expression of interferon ? 4 associated with nonresponse to interferon-based therapy in chronic hepatitis C.
25587616 2014 Interleukin-28B rs12979860 C allele: Protective against advanced fibrosis in chronic hepatitis C genotype 1 infection.
25563035 2014 Demographics, clinical characteristics, IFNL3- and IFNL4- polymorphisms in a cohort of hepatitis C patients from Puerto Rico.
25545640 2014 Influence of hepatitis C virus and IL28B genotypes on liver stiffness.
25503988 2014 IL-28B is a key regulator of B- and T-cell vaccine responses against influenza.
25470790 2015 Impact of IL28B genotype on first-week response to telaprevir-based therapy in HIV-HCV coinfection.
25461389 2015 Increased concentration of interferon lambda-3, interferon beta and interleukin-10 in the cerebrospinal fluid of patients with tick-borne encephalitis.
25460552 2015 A polymorphism in interferon L3 is an independent risk factor for development of hepatocellular carcinoma after treatment of hepatitis C virus infection.
25420838 2014 CC genotype at rs12979860 of IL28B is associated with lower risk of new-onset diabetes after transplantation in adult patients with liver transplantation for hepatitis C cirrhosis.
25391769 2015 Frequency of interleukin 28B rs12979860 C>T variants in Filipino patients chronically infected with hepatitis B virus.
25389973 2014 IL28B polymorphism cannot predict response to interferon alpha treatment in patients with melanoma.
25355870 2015 Impact and regulation of lambda interferon response in human metapneumovirus infection.
25332265 The role of interleukin 28B gene polymorphism in Turkish patients with hepatocellular carcinoma.
25312023 2015 IL28B genetic variations are associated with treatment response of patients with chronic hepatitis C in a Chinese Han population.
25301956 2015 Influence of IFNL3/4 polymorphisms on the incidence of cytomegalovirus infection after solid-organ transplantation.
25286525 [Clinical significance of interleukin-28B and RNAse L gene polymorphism determination in patients with chronic viral hepatitis C].
25278709 2014 IL28B polymorphism genotyping as predictor of rapid virologic response during interferon plus ribavirin treatment in hepatitis C virus genotype 1 patients.
25256151 2014 Interferon lambda 3 genotype predicts hepatitis C virus RNA levels in early acute infection among people who inject drugs: the InC(3) study.
25233462 2014 IL28B gene polymorphism SNP rs8099917 genotype GG is associated with HTLV-1-associated myelopathy/tropical spastic paraparesis (HAM/TSP) in HTLV-1 carriers.
25227816 2014 IL28B rs12979860 gene polymorphism in Egyptian patients with chronic liver disease infected with HCV.
25174990 2015 BMI, male sex and IL28B genotype associated with persistently high hepatitis C virus RNA levels among chronically infected drug users up to 23 years following seroconversion.
25132781 2014 Early viral kinetics during hepatitis C virus genotype 6 treatment according to IL28B polymorphisms.
25115611 2015 Is rs8099917 polymorphism of IL-28B gene a good predictor of response to therapy of HCV than rs12979860? An Egyptian study.
25048205 2014 In vitro blood cell responsiveness to IFN-? predicts clinical response independently of IL28B in hepatitis C virus genotype 1 infected patients.
25041342 2015 Association of HLA-DP/DQ, STAT4 and IL-28B variants with HBV viral clearance in Tibetans and Uygurs in China.
25039676 2015 Interleukin-28B genetic variants in untreated Italian HCV-infected patients: a multicentre study.
25034356 2014 Impact of IL28B on the treatment decision in naïve and experienced patients with genotype 1 and 4 chronic hepatitis C in real-life clinical practice: a prospective multicenter cohort.
25032184 2014 No association between the IL28B SNP and response to peginterferon plus ribavirin combination treatment in Korean chronic hepatitis C patients.
24999753 2014 Interleukin 28B polymorphisms and therapy response in Egyptian hepatitis C genotype-4 patients.
24995561 2015 Association of interleukin 28B polymorphism and mutations in the NS5A region of hepatitis C virus genotype 2 with interferon responsiveness.
24994464 2014 Low IL10 serum levels as key factor for predicting the sustained virological response to IFN?/ribavirin in Brazilian patients with HCV carrying IL28B CT/TT genotype.
24969847 2014 Association of MRC-1 and IL-28B with the treatment outcome of hepatitis C: a case control study.
24951853 2014 Occasional spontaneous clearance of chronic hepatitis C virus in HIV-infected individuals.
24929144 2014 KIR3DL1-HLA-Bw4 combination and IL28B polymorphism predict response to Peg-IFN and ribavirin with and without telaprevir in chronic hepatitis C.
24927606 PNPLA3 rs738409 causes steatosis according to viral & IL28B genotypes in hepatitis C.
24914551 2014 Impact of host IL28B rs12979860, rs8099917 in interferon responsiveness and advanced liver disease in chronic genotype 3 hepatitis C patients.
24905495 2015 Revisiting liver disease progression in HIV/HCV-coinfected patients: the influence of vitamin D, insulin resistance, immune status, IL28B and PNPLA3.
24905490 2014 Apolipoprotein H expression is associated with IL28B genotype and viral clearance in hepatitis C virus infection.
24898388 2014 Genotype CC of rs12979860 is providing protection against infection rather than assisting in treatment response for HCV genotype 3a infection.
24874053 2014 Influence of interleukin-28B polymorphism on progression to hepatitis virus-induced hepatocellular carcinoma.
24845613 2014 Protection against hepatitis C infection via NK cells in highly-exposed uninfected injecting drug users.
24840747 2014 Correlation between the genetic variations in interleukin 28B and chronic hepatitis C virus genotypes in the Chinese population.
24840315 2015 Interleukin-28 gene polymorphisms may contribute to HBsAg persistence and the development of HBeAg-negative chronic hepatitis B.
24817780 2014 Absence of correlation between IL-28B gene polymorphisms and the clinical presentation of chronic hepatitis B in an Amazon Brazilian population.
24792632 2014 Interleukin 28B rs12979860 single-nucleotide polymorphism predicts spontaneous clearance of hepatitis C virus in children.
24782280 2014 IFNL3 (IL28B) and IFNL4 polymorphisms are associated with treatment response in Thai patients infected with HCV genotype 1, but not with genotypes 3 and 6.
24776764 2014 The association of IL28B genotype with the histological features of chronic hepatitis C is HCV genotype dependent.
24770613 2014 Association of genetic variants with rapid fibrosis: progression after liver transplantation for hepatitis C.
24768758 2014 IFNL3 polymorphisms predict response to therapy in chronic hepatitis C genotype 2/3 infection.
24751921 2014 Interferon-? in the context of viral infections: production, response and therapeutic implications.
24707497 2014 Impact of immunogenetic IL28B polymorphism on natural outcome of HCV infection.
24678513 2014 SNP rs8099917 in gene IL28B might be associated with risk of chronic infection by HCV but not with response to treatment.
24672032 2014 Reduction of microRNA 122 expression in IFNL3 CT/TT carriers and during progression of fibrosis in patients with chronic hepatitis C.
24662995 2014 IL28B polymorphisms and clinical implications for hepatitis C virus infection in Uzbekistan.
24659876 2014 Individualization of chronic hepatitis C treatment according to the host characteristics.
24646752 2014 IFNL4/IL-28B haplotype structure and its impact on susceptibility to hepatitis C virus and treatment response in the Japanese population.
24637774 2014 Impact of IL28B genetic variation on HCV-induced liver fibrosis, inflammation, and steatosis: a meta-analysis.
24620020 2014 Immunomodulatory Function of Interleukin 28B during primary infection with cytomegalovirus.
24599320 2014 Impact of donor and recipient single nucleotide polymorphisms of IL28B rs8099917 in living donor liver transplantation for hepatitis C.
24583931 2014 Efficacy of entecavir in chronic hepatitis B patients with persistently normal alanine aminotransferase: randomized, double-blind, placebo-controlled study.
24579307 2013 [The function and application of the IL28B gene in HCV infection and treatment].
24553484 2014 Impact of comorbid hepatic steatosis on treatment of chronic hepatitis C in Japanese patients and the relationship with genetic polymorphism of IL28B, PNPLA3 and LDL receptor.
24532585 2014 IPS-1 is essential for type III IFN production by hepatocytes and dendritic cells in response to hepatitis C virus infection.
24523350 2014 Interleukin 28B genotype and insulin resistance in chronic hepatitis C patients.
24522196 2014 Interferon lambda 3 rs12979860 polymorphism in patients with haemophilia and HCV infection: a predictor of spontaneous viral clearance and sustained virological response.
24517415 2015 Association of IL28B polymorphisms with peginterferon treatment response in Chinese Han patients with HBeAg-positive chronic hepatitis B.
24516704 2014 Role of interleukin-28B genetic polymorphisms in Korean patients with hepatitis C virus infection.
24480970 2014 Interleukin 28B gene polymorphisms and Epstein-Barr virus-associated lymphoproliferative diseases.
24465773 2014 Comparative analysis of rs12979860 SNP of the IFNL3 gene in children with hepatitis C and ethnic matched controls using 1000 Genomes Project data.
24445571 2014 Host and viral determinants of the outcome of exposure to HCV infection genotype 4: a large longitudinal study.
24438679 2014 Impact of the peginterferon-? 2a and ribavirin plasma levels on viral kinetics and sustained virological response in genotype 1 HCV/HIV-co-infected patients with the unfavourable non-CC IL28B genotypes.
24438678 2014 Relationship between polymorphisms near the IL28B gene and spontaneous HBsAg seroclearance: a systematic review and meta-analysis.
24415442 2014 Interleukin-28b CC genotype predicts early treatment response and CT/TT genotypes predicts non-response in patients infected with HCV genotype 3.
24398031 2014 IL28B and IL10R -1087 polymorphisms are protective for chronic genotype 1 HCV infection and predictors of response to interferon-based therapy in an East-Central European cohort.
24396987 2013 Rs12979860 and rs8099917 single nucleotide polymorphisms of interleukin-28B gene: simultaneous genotyping in caucasian patients infected with hepatitis C virus.
24389274 Viral genotypes and human rs12979860 polymorphism of the IFNL3 gene in hepatitis C infected patients in Southern Brazil.
24387833 2014 No impact of interleukin-28B polymorphisms on spontaneous or drug-induced hepatitis delta virus clearance.
24385435 2014 Transcriptional regulation of IFN-? genes in hepatitis C virus-infected hepatocytes via IRF-3·IRF-7·NF-?B complex.
24379268 2013 [The role of hepcidin and polymorphisms in the regulatory region of the IL-28B gene in HCV infections].
24374819 2014 Effect of the IL28B Rs12979860 C/T polymorphism on the incidence and features of active cytomegalovirus infection in allogeneic stem cell transplant patients.
24349500 2013 KIR, HLA, and IL28B variant predict response to antiviral therapy in genotype 1 chronic hepatitis C patients in Japan.
24335707 2014 Hepatic metallothionein expression in chronic hepatitis C virus infection is IFNL3 genotype-dependent.
24325405 2014 Role of IL28B for chronic hepatitis C treatment toward personalized medicine.
24311440 2014 Hepatic interferon-stimulated genes are differentially regulated in the liver of chronic hepatitis C patients with different interleukin-28B genotypes.
24302757 2014 Natural cytotoxicity receptor-dependent natural killer cytolytic activity directed at hepatitis C Virus (HCV) is associated with liver inflammation, African American race, IL28B genotype, and response to pegylated interferon/ribavirin therapy in chronic HCV infection.
24293567 2014 Interleukin 28B gene polymorphisms in hepatitis C virus-related cryoglobulinemic vasculitis.
24287582 2014 Baseline factors and very early viral response (week 1) for predicting sustained virological response in telaprevir-based triple combination therapy for Japanese genotype 1b chronic hepatitis C patients: a multicenter study.
24270810 2013 High-content genome-wide RNAi screens identify regulators of parkin upstream of mitophagy.
24269996 2014 Genetic polymorphisms of the IFN? genes are associated with biochemical features in Han Chinese with HCV infection from Yunnan Province, China.
24259970 2013 Interleukin 28B-related polymorphisms: a pathway for understanding hepatitis C virus infection?
24244641 2013 Impact of Il28b-related single nucleotide polymorphisms on liver transient elastography in chronic hepatitis C infection.
24241692 2014 The favorable IFNL3 genotype escapes mRNA decay mediated by AU-rich elements and hepatitis C virus-induced microRNAs.
24222948 2013 Interaction of IFNL3 with insulin resistance, steatosis and lipid metabolism in chronic hepatitis C virus infection.
24204859 2013 Association of IFNL3 rs12979860 and rs8099917 with biochemical predictors of interferon responsiveness in chronic hepatitis C virus infection.
24188401 2014 Hepatitis C virus infection alters lipid metabolism depending on IL28B polymorphism and viral genotype and modulates gene expression in vivo and in vitro.
24167602 2013 A fast and cost-effective method for identifying a polymorphism of interleukin 28B related to hepatitis C.
24144988 2014 Evaluation of the relationship between IL28B, IL10RB and IL28RA single-nucleotide polymorphisms and susceptibility to hepatitis C virus in Chinese Han population.
24118788 2014 Genetic variation in interleukin 28B and correlation with chronic hepatitis B virus infection in Saudi Arabian patients.
24117654 2014 Impact of IL28B polymorphisms on 24-week telaprevir-based combination therapy for Asian chronic hepatitis C patients with hepatitis C virus genotype 1b.
24116050 2013 A single nucleotide polymorphism associated with hepatitis C virus infections located in the distal region of the IL28B promoter influences NF-?B-mediated gene transcription.
24102823 2014 Strong prediction of virological response to combination therapy by IL28B gene variants rs12979860 and rs8099917 in chronic hepatitis C genotype 4.
24096049 2014 High hepatitis B virus surface antigen levels and favorable interleukin 28B genotype predict spontaneous hepatitis C virus clearance in uremic patients.
24085431 2013 Association of the interleukin-28B gene polymorphism with development of hepatitis virus-related hepatocellular carcinoma and liver cirrhosis: a meta-analysis.
24081499 2014 Role of interleukin 28-B in the spontaneous and treatment-related clearance of HCV infection in patients with chronic HBV/HCV dual infection.
24070114 2014 Lambda interferon serum levels in patients with chronic hepatitis C virus infection according to their response to therapy with pegylated interferon and ribavirin.
24057245 2013 Chronic hepatitis B and IL28B rs12979860 polymorphism: preliminary study.
24045339 2014 IFNL3 mediates interaction between innate immune cells: Implications for hepatitis C virus pathogenesis.
24039107 2013 Interleukin-28B and fibrosing cholestatic hepatitis in posttransplant hepatitis C: a case-control study and literature review.
24026885 2014 Association of polymorphisms in interleukin-18 and interleukin-28B genes with outcomes of hepatitis B virus infections: a meta-analysis.
23981065 2014 Association of IL28B polymorphism with fibrosis, liver inflammation, gender respective natural history of hepatitis C virus in Egyptian patients with genotype 4.
23950709 2013 A systematic analysis of host factors reveals a Med23-interferon-? regulatory axis against herpes simplex virus type 1 replication.
23936821 2013 Cirrhosis and rapid virological response to peginterferon plus ribavirin determine treatment outcome in HCV-1 IL28B rs12979860 CC patients.
23936294 2013 IL28B gene polymorphisms and US liver fatty changes in patients who spontaneously cleared hepatitis C virus infection.
23916907 2013 [IL28B CC genotype: a protective factor and predictor of the response to interferon treatment in chronic hepatitis C virus infection].
23908124 2014 The effects of female sex, viral genotype, and IL28B genotype on spontaneous clearance of acute hepatitis C virus infection.
23880623 2013 Single-nucleotide polymorphisms of IL-10 and IL-28B as predictors of the response of IFN therapy in HCV genotype 4-infected children.
23874902 2013 Association between IL28B polymorphisms and spontaneous clearance of hepatitis B virus infection.
23860735 2014 Genetic variation near interleukin 28B and the risk of hepatocellular carcinoma in patients with chronic hepatitis C.
23859071 2013 Investigation of PNPLA3 and IL28B genotypes on diabetes and obesity after liver transplantation: insight into mechanisms of disease.
23850879 2013 Temperature rise after peginterferon alfa-2a injection in patients with chronic hepatitis C is associated with virological response and is modulated by IL28B genotype.
23829453 2014 Value of interleukin-28B genetic polymorphism on retreatment outcomes of chronic hepatitis C genotype 1 relapsers by peginterferon alfa plus ribavirin.
23826153 2013 Variation in both IL28B and KIR2DS3 genes influence pegylated interferon and ribavirin hepatitis C treatment outcome in HIV-1 co-infection.
23784926 2013 Role of IL28B gene polymorphism and cell-mediated immunity in spontaneous resolution of acute hepatitis C.
23782163 2013 Interleukin-28B genetic variations and spontaneous clearance of hepatitis C antibody-positive blood donors in China.
23730840 2013 Role of IL28B and inosine triphosphatase polymorphisms in the treatment of chronic hepatitis C virus genotype 6 infection.
23722013 2013 Interaction between calcineurin inhibitors and IL-28B rs12979860 C>T polymorphism and response to treatment for post-transplant recurrent hepatitis C.
23712427 2013 IL28B expression depends on a novel TT/-G polymorphism which improves HCV clearance prediction.
23703931 2013 Association of IL28B genotype with fibrosis progression and clinical outcomes in patients with chronic hepatitis C: a longitudinal analysis.
23689989 2014 IL28B minor allele is associated with a younger age of onset of hepatocellular carcinoma in patients with chronic hepatitis C virus infection.
23652058 2013 Gene polymorphisms of interleukin-28, p21-activated protein kinases 4, and response to interferon-? based therapy in Chinese patients with chronic hepatitis B.
23647954 2013 IL-28B polymorphisms and the response to antiviral therapy in HCV genotype 2 and 3 varies by ethnicity: a meta-analysis.
23615070 Polymorphisms in histone deacetylases improve the predictive value of IL-28B for chronic hepatitis C therapy.
23611115 2013 Impact of interleukin 28B polymorphisms on spontaneous clearance of hepatitis C virus infection: a meta-analysis.
23594959 CCR5-?32 genotype does not improve predictive value of IL28B polymorphisms for treatment response in chronic HCV infection.
23591768 2014 Ex vivo induction of IFN-?3 by a TLR7 agonist determines response to Peg-IFN/ribavirin therapy in chronic hepatitis C patients.
23587473 2013 Treatment optimization and prediction of HCV clearance in patients with acute HCV infection.
23570849 2013 In HIV/HCV coinfected patients dendritic cell activation state is not associated with IL28B genotype.
23564024 2013 Association of IL-12B gene rs6887695 polymorphism with hereditary susceptibility and clinical characterization of psoriasis vulgaris in the Chinese Han population.
23532802 2013 Role of interleukin-28B polymorphism as a predictor of sustained virological response in patients with chronic hepatitis C treated with triple therapy: a systematic review and meta-analysis.
23522062 2013 IL28B genotype and the expression of ISGs in normal liver.
23490371 2013 Genetic variations in host IL28B links to the detection of peripheral blood mononuclear cells-associated hepatitis C virus RNA in chronically infected patients.
23486666 2013 'Favourable' IL28B polymorphisms are associated with a marked increase in baseline viral load in hepatitis C virus subtype 3a infection and do not predict a sustained virological response after 24 weeks of therapy.
23469142 2013 IL28B polymorphism correlates with active hepatitis in patients with HBeAg-negative chronic hepatitis B.
23455512 2013 IL28B SNP screening and distribution in the French Canadian population using a rapid PCR-based test.
23449268 2013 HLA-DP and IL28B polymorphisms: influence of host genome on hepatitis B surface antigen seroclearance in chronic hepatitis B.
23442843 2013 Role of interleukin 28B-related gene polymorphisms in chronic hepatitis C and the response to antiviral therapy in Koreans.
23440114 2013 Response to treatment in Brazilian patients with chronic hepatitis C is associated with a single-nucleotide polymorphism near the interleukin-28B gene.
23426277 2013 Association of interleukin-28B genotype and hepatocellular carcinoma recurrence in patients with chronic hepatitis C.
23420232 2013 Genome-wide association study of spontaneous resolution of hepatitis C virus infection: data from multiple cohorts.
23382988 2013 The association of IL28B polymorphism and graft survival in patients with hepatitis C undergoing liver transplantation.
23358556 2013 Genetic variation in the interleukin-28B gene is associated with spontaneous clearance and progression of hepatitis C virus in Moroccan patients.
23343781 2013 Polymorphisms near interleukin 28B gene are not associated with hepatitis B virus clearance, hepatitis B e antigen clearance and hepatocellular carcinoma occurrence.
23333445 2013 Differential effects of donor and recipient IL28B and DDX58 SNPs on severity of HCV after liver transplantation.
23323251 2012 Efficacy of peginterferon and ribavirin is associated with the IL28B gene in Korean patients with chronic hepatitis C.
23323000 2012 Interleukin-28 and hepatitis C virus genotype-4: treatment-induced clearance and liver fibrosis.
23314745 2013 Impact of IL-28B polymorphisms on pegylated interferon plus ribavirin treatment response in children and adolescents infected with HCV genotypes 1 and 4.
23301835 2013 IL28B genotype is not useful for predicting treatment outcome in Asian chronic hepatitis B patients treated with pegylated interferon-?.
23301546 2013 Role of IL-28B and inosine triphosphatase polymorphisms in efficacy and safety of Peg-Interferon and ribavirin in chronic hepatitis C compensated cirrhosis with and without oesophageal varices.
23298311 2013 Meta-analysis: implications of interleukin-28B polymorphisms in spontaneous and treatment-related clearance for patients with hepatitis C.
23293195 Patients younger than forty years old with hepatitis C virus genotype-1 chronic infection had treatment responses similar to genotype-2 infection and not related to interleukin-28B polymorphism.
23266640 2013 Interleukin-28B rs12979860C/T and rs8099917T/G contribute to spontaneous clearance of hepatitis C virus in Caucasians.
23259930 2012 Lack of evidence to support the association of a single IL28B genotype SNP rs12979860 with the HTLV-1 clinical outcomes and proviral load.
23237012 2013 IL28B polymorphism, blood interferon-alpha concentration, and disease stage of HCV mono-infected and HCV-HIV co-infected patients.
23227209 2012 Association analysis between SNPs in IL-28B gene and the progress of hepatitis B infection in Han Chinese.
23225905 2013 IL28B single-nucleotide polymorphism rs12979860 is associated with spontaneous HIV control in white subjects.
23220171 2013 Effects of IL28B rs12979860 CC genotype on metabolic profile and sustained virologic response in patients with genotype 1 chronic hepatitis C.
23207147 2013 Interferon-?s: special immunomodulatory agents and potential therapeutic targets.
23197895 2012 Novel biosensor-based microarray assay for detecting rs8099917 and rs12979860 genotypes.
23196939 2013 Interferon-stimulated genes are associated with peginterferon/ribavirin treatment response regardless of IL28B alleles in hepatitis C virus/HIV-coinfected patients.
23173032 2012 None of the six SNPs of IL28B could predict treatment responses in genotype 2 chronic HCV infected patients by propensity score matching analysis.
23164695 2013 IL28B rs12979860 polymorphism influences serum TNFalpha levels in chronic hepatitis C.
23159283 2013 Importance of IL-10 and IL-6 during chronic hepatitis C genotype-1 treatment and their relation with IL28B.
23151203 2012 Interferon stimulated genes and hepatitis C virus infection.
23149444 2012 Negative predictive value of IL28B, SLC28A2, and CYP27B1 SNPs and low RBV plasma exposure for therapeutic response to PEG/IFN-RBV treatment.
23147144 2012 A single nucleotide polymorphism, rs129679860, in the IL28B locus is associated with the viral kinetics and a sustained virological response in a chronic, monoinfected hepatitis C virus genotype-1 Brazilian population treated with pegylated interferon-ribavirin.
23142377 2013 Association study of IL28B: rs12979860 and rs8099917 polymorphisms with SVR in patients infected with chronic HCV genotype 1 to PEG-INF/RBV therapy using systematic meta-analysis.
23137758 2013 Genetic polymorphisms of ICAM 1 and IL28 as predictors of liver fibrosis severity and viral clearance in hepatitis C genotype 4.
23135762 2013 Hepatitis C virus kinetics by administration of pegylated interferon-? in human and chimeric mice carrying human hepatocytes with variants of the IL28B gene.
23133602 2012 Pharmacogenetics of efficacy and safety of HCV treatment in HCV-HIV coinfected patients: significant associations with IL28B and SOCS3 gene variants.
23121365 2012 IL28B genetic variation and hepatitis C virus-specific CD4(+) T-cell responses in anti-HCV-positive blood donors.
23121166 2013 Insulin resistance predicts sustained virological response to treatment of chronic hepatitis C independently of the IL28b rs12979860 polymorphism.
23118858 2012 Evaluation of IL-28B polymorphisms and serum IP-10 in hepatitis C infected chimpanzees.
23109451 IL28B polymorphisms predict the response to chronic hepatitis C virus infection treatment in a Mexican population.
23107586 2013 CC genotype donors for the interleukin-28B single nucleotide polymorphism are associated with better outcomes in hepatitis C after liver transplant.
23103287 2013 IL28B polymorphisms are associated with severity of liver disease in human immunodeficiency virus (HIV) patients coinfected with hepatitis C virus.
23101227 2012 [The occurrence of HCV genotypes and single polynucleotide polymorphisms of rs12979860 among HCV infected patients in northeastern Poland].
23090351 2012 Optimum ribavirin exposure overcomes racial disparity in efficacy of peginterferon and ribavirin treatment for hepatitis C genotype 1.
23083820 2012 IL28B polymorphisms as a pretreatment predictor of response to HCV treatment.
23080496 2012 A single nucleotide polymorphism in IL28B affects viral evolution of hepatitis C quasispecies after pegylated interferon and ribavirin therapy.
23030669 2013 Interleukin 28B rs12979860 (CT/TT) genotype is associated with milder hepatic damage in the natural evolution of HCV/HIV coinfection.
23020144 2012 Polymorphisms in interleukin-10 and interleukin-28B genes in Egyptian patients with chronic hepatitis C virus genotype 4 and their effect on the response to pegylated interferon/ribavirin-therapy.
23008132 2013 Interleukin-28B polymorphism in hepatitis C and liver transplantation.
23002361 2012 IL28B polymorphism as a predictor of antiviral response in chronic hepatitis C.
22986179 2012 Association of IL-10, IL-4, and IL-28B gene polymorphisms with spontaneous clearance of hepatitis C virus in a population from Rio de Janeiro.
22967712 2012 Association of three SNPs in interleukin-28B with graft hepatic dysfunction after liver transplantation in Chinese Han population.
22966241 2012 The impact of interferon lambda 3 gene polymorphism on natural course and treatment of hepatitis C.
22964578 2012 High predictability of a sustained virological response (87%) in chronic hepatitis C virus genotype 1 infection treatment by combined IL28B genotype analysis and ?-glutamyltransferase/alanine aminotransferase ratio: a retrospective single-center study.
22943900 2012 [Correlation between interleukin-28B genetic polymorphisms and primary hepatocellular carcinoma].
22930497 2012 IL28B polymorphism is not associated with HCV protease diversity in patients co-infected with HIV and HCV treated with pegylated interferon and ribavirin.
22913807 2013 Genetic polymorphism of IL28B in hepatitis C-infected haemophilia patients in Israel.
22898703 2012 Interleukin 28B genetic polymorphisms play a minor role in identifying optimal treatment duration in HCV genotype 1 slow responders to pegylated interferon plus ribavirin.
22882858 2012 Relationship between the genetic variation in interleukin 28B and response to antiviral therapy in patients with chronic hepatitis C.
22790387 2012 Increased risk of severe hepatitis C virus recurrence after liver transplantation in patients with a T allele of IL28B rs12979860.
22766768 2012 The course of posttransplant hepatitis C infection: comparative impact of donor and recipient source of the favorable IL28B genotype and other variables.
22762459 Interleukin-28B polymorphisms are associated with fibrosing cholestatic hepatitis in recurrent hepatitis C after liver transplantation.
22727259 2012 Different impact of IL28B polymorphisms on response to peginterferon-? plus ribavirin in HIV-positive patients infected with HCV subtypes 1a or 1b.
22719902 2012 Analysis of IL28B variants in an Egyptian population defines the 20 kilobases minimal region involved in spontaneous clearance of hepatitis C virus.
22666430 2012 Relation of IL28B gene polymorphism with biochemical and histological features in hepatitis C virus-induced liver disease.
22649509 2012 IL28B genetic variation is associated with spontaneous clearance of hepatitis C virus, treatment response, serum IL-28B levels in Chinese population.
22641049 2012 Genetics of IL28B and HCV--response to infection and treatment.
22634340 2012 Association of the IL28B genotype with insulin resistance in patients with chronic hepatitis C.
22613000 2012 Insulin resistance undermines the advantages of IL28B polymorphism in the pegylated interferon alpha-2b and ribavirin treatment of chronic hepatitis C patients with genotype 1.
22612303 2012 Meta-analysis: IL-28B genotype and sustained viral clearance in HCV genotype 1 patients.
22591106 2012 Meta-analysis: IL28B polymorphisms predict sustained viral response in HCV patients treated with pegylated interferon-? and ribavirin.
22577043 2012 Comprehensive analysis for viral elements and interleukin-28B polymorphisms in response to pegylated interferon plus ribavirin therapy in hepatitis C virus 1B infection.
22555162 2012 Hepatitis C viral load, genotype 3 and interleukin-28B CC genotype predict mortality in HIV and hepatitis C-coinfected individuals.
22545770 2012 IL28B CC genotype is associated with higher all-cause mortality in antiretroviral-treated HIV-infected patients.
22543885 2012 The association of genetic variants with hepatic steatosis in patients with genotype 1 chronic hepatitis C infection.
22530607 2012 Implications of PNPLA3 polymorphism in chronic hepatitis C patients receiving peginterferon plus ribavirin.
22525303 2012 Update on the management and treatment of hepatitis C virus infection: recommendations from the Department of Veterans Affairs Hepatitis C Resource Center Program and the National Hepatitis C Program Office.
22521356 2012 Immediate vs. delayed treatment in patients with acute hepatitis C based on IL28B polymorphism: a model-based analysis.
22511448 2012 Introduction to the genetics and biology of interleukin-28B.
22509814 2012 Frequency of IL28B rs12979860 single-nucleotide polymorphism alleles in newborn infants and in patients with chronic hepatitis C in Morocco.
22505587 2012 Vitamin D levels and IL28B polymorphisms are related to rapid virological response to standard of care in genotype 1 chronic hepatitis C.
22497812 2012 Interleukin 28B polymorphisms are the only common genetic variants associated with low-density lipoprotein cholesterol (LDL-C) in genotype-1 chronic hepatitis C and determine the association between LDL-C and treatment response.
22495472 2012 Recipient interleukin-28B Rs12979860 C/T polymorphism and acute cellular rejection after liver transplantation: role of the calcineurin inhibitor used.
22473858 2013 IL28B polymorphisms predict interferon-related hepatitis B surface antigen seroclearance in genotype D hepatitis B e antigen-negative patients with chronic hepatitis B.
22460962 2012 Development of tropical spastic paraparesis in human T-lymphotropic virus type 1 carriers is influenced by interleukin 28B gene polymorphisms.
22431022 2012 The interleukin 28B rs12979860 C/T polymorphism and serum cholesterol as predictors of fibrosis progression in patients with chronic hepatitis C and persistently normal transaminases.
22411462 2012 Role of IL28B polymorphism in the development of hepatitis C virus-induced hepatocellular carcinoma, graft fibrosis, and posttransplant antiviral therapy.
22374338 2012 Evaluation of interleukin 28B single nucleotide polymorphisms in infants suffering from bronchiolitis.
22350701 2012 IL28B polymorphism is associated with fatty change in the liver of chronic hepatitis C patients.
22336134 2012 Paradoxical expression of IL-28B mRNA in peripheral blood in human T-cell leukemia virus type-1 mono-infection and co-infection with hepatitis C virus.
22329371 2012 IL28B genetic variants and gender are associated with spontaneous clearance of hepatitis C virus infection.
22328925 2012 Deciphering the interleukin 28B variants that better predict response to pegylated interferon-? and ribavirin therapy in HCV/HIV-1 coinfected patients.
22325058 2012 Association of polymorphisms in interleukin-18 and interleukin-28B with hepatitis B recurrence after liver transplantation in Chinese Han population.
22324878 2012 Short communication: Does interleukin-28B single nucleotide polymorphisms influence the natural history of hepatitis B?
22314430 2012 IL28B and PNPLA3 polymorphisms affect histological liver damage in patients with non-alcoholic fatty liver disease.
22313623 2012 The impact of IL28B genotype on the gene expression profile of patients with chronic hepatitis C treated with pegylated interferon alpha and ribavirin.
22310928 2012 Genetic variation in IL28B is associated with the development of hepatitis B-related hepatocellular carcinoma.
22300408 2012 Recipient IL28B polymorphism is an important independent predictor of posttransplant diabetes mellitus in liver transplant patients with chronic hepatitis C.
22298465 2012 Early viral load and recipient interleukin-28B rs12979860 genotype are predictors of the progression of hepatitis C after liver transplantation.
22295096 2012 Genetic variations in IL28B and allergic disease in children.
22285807 2012 Hepatic cell-type specific gene expression better predicts HCV treatment outcome than IL28B genotype.
22277049 2012 IL-28B genetic variant is associated with the risk of schizophrenia in the Chinese Han population.
22263608 2012 Genetic variation in IL28B and treatment outcome in HBeAg-positive and -negative chronic hepatitis B patients treated with Peg interferon alfa-2a and adefovir.
22257210 2012 A tetra-primer amplification refractory mutation system-polymerase chain reaction for the detection of rs8099917 IL28B genotype.
22253847 2012 Sequence analysis of the IL28A/IL28B inverted gene duplication that contains polymorphisms associated with treatment response in hepatitis C patients.
22253715 2012 Impact of IL28B-related single nucleotide polymorphisms on liver histopathology in chronic hepatitis C genotype 2 and 3.
22248659 2012 Effect of IL28B genotype on early viral kinetics during interferon-free treatment of patients with chronic hepatitis C.
22247028 2011 [Genetic polymorphisms as new predictive factors for successful treatment of chronic hepatitis C].
22245236 2012 Association of IL28B gene polymorphism with development of hepatocellular carcinoma in Japanese patients with chronic hepatitis C virus infection.
22239156 2012 IL28B rs12979860 polymorphism does not influence outcomes of hepatitis B virus infection.
22234924 2012 Combined effects of different interleukin-28B gene variants on the outcome of dual combination therapy in chronic hepatitis C virus type 1 infection.
22200702 2011 [Relationship between single nucleotide polymorphisms in IL28B gene and response to interferon treatment in chronic hepatitis B patients].
22193282 2012 Host interleukin-28B genetic variants versus viral kinetics in determining responses to standard-of-care for Asians with hepatitis C genotype 1.
22192885 2012 Serum level of IP-10 increases predictive value of IL28B polymorphisms for spontaneous clearance of acute HCV infection.
22189977 2011 The impact of human gene polymorphisms on HCV infection and disease outcome.
22180419 2012 IL28B polymorphisms influence stage of fibrosis and spontaneous or interferon-induced viral clearance in thalassemia patients with hepatitis C virus infection.
22180014 2012 IL28B alleles associated with poor hepatitis C virus (HCV) clearance protect against inflammation and fibrosis in patients infected with non-1 HCV genotypes.
22174846 2011 Hepatic STAT1-nuclear translocation and interleukin 28B polymorphisms predict treatment outcomes in hepatitis C virus genotype 1-infected patients.
22168813 2012 Discovery of critical host factor, IL-28B, associated with response to hepatitis C virus treatment.
22156487 2011 Association of interleukin-28B and hepatitis C genotype 1 with a high viral load and response to pegylated interferon plus ribavirin therapy.
22155912 2011 IL28B CC-genotype association with HLA-DQB1*0301 allele increases the prediction of spontaneous HCV RNA clearance in thalassaemic HCV-infected patients.
22117591 2012 IL28B and interferon-gamma inducible protein 10 for prediction of rapid virologic response and sustained virologic response in HIV-HCV-coinfected patients.
22110669 2011 Female sex and IL28B, a synergism for spontaneous viral clearance in hepatitis C virus (HCV) seroconverters from a community-based cohort.
22108195 2012 Polymorphisms near IL28B and serologic response to peginterferon in HBeAg-positive patients with chronic hepatitis B.
22098416 2012 IL28B polymorphisms are markers of therapy response and are influenced by genetic ancestry in chronic hepatitis C patients from an admixed population.
22096924 2011 [Relation of IL28B gene polymorphism to chronic hepatitis C].
22052088 2012 Interleukin-28B genotypes determine response to pegylated-interferon plus ribavirin therapy in patients with hepatitis C virus infection.
22046316 2011 Genetic variation of the IL-28B promoter affecting gene expression.
22027585 2012 Single nucleotide polymorphism upstream of interleukin 28B associated with phase 1 and phase 2 of early viral kinetics in patients infected with HCV genotype 1.
22013224 2011 IL28B rs12979860 genotype and spontaneous clearance of hepatitis C virus in a multi-ethnic cohort of injection drug users: evidence for a supra-additive association.
21987611 2011 IL28B polymorphisms associated with therapy response in Chilean chronic hepatitis C patients.
21983945 2011 Natural killer inhibitory receptor expression associated with treatment failure and interleukin-28B genotype in patients with chronic hepatitis C.
21974859 2011 Association between IL28B polymorphisms and first-phase viral load decrease in chronic hepatitis C virus-infected patients treated with peginterferon alfa-2b/ribavirin.
21951981 2012 IL28B polymorphism is associated with treatment response in patients with genotype 4 chronic hepatitis C.
21933876 2011 Genetic polymorphism in IL28B is associated with spontaneous clearance of hepatitis C virus genotype 4 infection in an Egyptian cohort.
21932415 2012 Interleukin 28B polymorphism predicts pegylated interferon plus ribavirin treatment outcome in chronic hepatitis C genotype 4.
21931540 2011 IL28B, HLA-C, and KIR variants additively predict response to therapy in chronic hepatitis C virus infection in a European Cohort: a cross-sectional study.
21911885 Genetic variation in interleukin-28B predicts SVR in hepatitis C genotype 1 Argentine patients treated with PEG IFN and ribavirin.
21905441 New therapies for hepatitis C virus infection.
21900787 2011 A single IL28B genotype SNP rs12979860 determination predicts treatment response in patients with chronic hepatitis C Genotype 1 virus.
21898478 2012 Association of gene expression involving innate immunity and genetic variation in interleukin 28B with antiviral response.
21889215 2011 IL28B polymorphisms are not associated with the response to interferon-? in multiple sclerosis.
21884517 2011 IL28B genotype does not correlate with HIV control in African Americans.
21879313 2012 Genotype rs8099917 near the IL28B gene and amino acid substitution at position 70 in the core region of the hepatitis C virus are determinants of serum apolipoprotein B-100 concentration in chronic hepatitis C.
21876443 2011 Influence of the combination of low-density lipoprotein receptor and interleukin 28B genotypes on lipid plasma levels in HIV/hepatitis C-coinfected patients.
21861668 2011 IL28B polymorphism and genetic biomarkers of viral clearance in hepatitis C virus infection.
21861317 2011 IL28B polymorphism and the control of hepatitis C virus infection: ready for clinical use?
21813376 2011 Progression of liver fibrosis in HIV/HCV genotype 1 co-infected patients is related to the T allele of the rs12979860 polymorphism of the IL28B gene.
21800339 2011 Hepatitis C virus induces interferon-? and interferon-stimulated genes in primary liver cultures.
21790472 2012 IL28B polymorphism associated with spontaneous clearance of hepatitis C infection in a Southern Brazilian HIV type 1 population.
21760886 2011 An IL28B genotype-based clinical prediction model for treatment of chronic hepatitis C.
21750736 2011 Characterization of serum proteins associated with IL28B genotype among patients with chronic hepatitis C.
21745312 2011 Association of interleukin 28B and mutations in the core and NS5A region of hepatitis C virus with response to peg-interferon and ribavirin therapy.
21745278 2011 Expression and gene polymorphisms of interleukin 28B and hepatitis B virus infection in a Chinese Han population.
21739451 2011 Inverse association of IL28B genotype and liver mRNA expression of genes promoting or suppressing antiviral state.
21722179 2012 Predicting response to therapy in chronic hepatitis C: an approach combining interleukin-28B gene polymorphisms and clinical data.
21721028 2011 Genetic variation in the interleukin-28B gene is not associated with fibrosis progression in patients with chronic hepatitis C and known date of infection.
21703201 2011 The predictive value of IL28B gene polymorphism for spontaneous clearance in a single source outbreak cohort is limited in patients carrying the CCR5?32 mutation.
21703198 2011 Beneficial IL28B genotype associated with lower frequency of hepatic steatosis in patients with chronic hepatitis C.
21692944 2011 IL28B polymorphisms determine early viral kinetics and treatment outcome in patients receiving peginterferon/ribavirin for chronic hepatitis C genotype 1.
21674555 2011 Genetic variation in interleukin-28B locus is associated with spontaneous clearance of HCV in children with non-1 viral genotype infection.
21670772 2011 Importance of host genetic factors HLA and IL28B as predictors of response to pegylated interferon and ribavirin.
21647799 2011 Role of interleukin 28B rs12979860 C/T polymorphism on the histological outcome of chronic hepatitis C: relationship with gender and viral genotype.
21618576 2011 Impact of viral amino acid substitutions and host interleukin-28b polymorphism on replication and susceptibility to interferon of hepatitis C virus.
21615377 2011 Marked impact of IL28B genotype in the natural clearance of hepatitis C virus in patients with haemoglobinopathies.
21612542 2011 Translating pharmacogenetics into clinical practice: interleukin (IL)28B and inosine triphosphatase (ITPA) polymophisms in hepatitis C virus (HCV) infection.
21606533 2011 Interleukin 28B gene variation at rs12979860 determines early viral kinetics during treatment in patients carrying genotypes 2 or 3 of hepatitis C virus.
21600205 2011 A polymorphism in IL28B distinguishes exposed, uninfected individuals from spontaneous resolvers of HCV infection.
21592993 2011 Influence of interleukin-28B single-nucleotide polymorphisms on progression to liver cirrhosis in human immunodeficiency virus-hepatitis C virus-coinfected patients receiving antiretroviral therapy.
21501223 2011 Association of a single nucleotide polymorphism near the interleukin-28B gene with response to hepatitis C therapy in Asian patients.
21480318 2011 Complementary role of vitamin D deficiency and the interleukin-28B rs12979860 C/T polymorphism in predicting antiviral response in chronic hepatitis C.
21479134 2011 IL28B SNP rs12979860 is a critical predictor for on-treatment and sustained virologic response in patients with hepatitis C virus genotype-1 infection.
21466653 2011 Donor and recipient IL28B polymorphisms in HCV-infected patients undergoing antiviral therapy before and after liver transplantation.
21447862 2011 Association of genetic variation in IL28B with hepatitis C treatment-induced viral clearance in the Chinese Han population.
21439960 2011 High-dose pegylated interferon-? and ribavirin in nonresponder hepatitis C patients and relationship with IL-28B genotype (SYREN trial).
21413051 2011 Genetic variation in interleukin 28B with respect to vertical transmission of hepatitis C virus and spontaneous clearance in HCV-infected children.
21402922 2011 Innate immune genes synergize to predict increased risk of chronic disease in hepatitis C virus infection.
21390311 2011 Response prediction in chronic hepatitis C by assessment of IP-10 and IL28B-related single nucleotide polymorphisms.
21384511 2011 Relationship between the interleukin-28b gene polymorphism and the histological severity of hepatitis C virus-induced graft inflammation and the response to antiviral therapy after liver transplantation.
21382156 2011 Genes and hepatitis C: susceptibility, fibrosis progression and response to treatment.
21378537 2011 Association between IL28B gene polymorphisms and plasma HCV-RNA levels in HIV/HCV-co-infected patients.
21374656 2011 IL28B genetic variation and treatment response in patients with hepatitis C virus genotype 3 infection.
21360716 2011 Estimating the net contribution of interleukin-28B variation to spontaneous hepatitis C virus clearance.
21354446 2011 IL28B polymorphisms predict reduction of HCV RNA from the first day of therapy in chronic hepatitis C.
21325786 2012 Amino acid substitution in HCV core region and genetic variation near the IL28B gene affect viral dynamics during telaprevir, peginterferon and ribavirin treatment.
21257738 2011 Genetic variation in IL28B and treatment-induced clearance of hepatitis C virus in HIV-positive patients with acute and chronic hepatitis C.
21254188 2011 Hyponatremia in patients treated with terlipressin: mechanisms and implications for clinical practice.
21254179 2011 Interleukin-28B polymorphisms are associated with histological recurrence and treatment response following liver transplantation in patients with hepatitis C virus infection.
21254158 2011 Quantitation of pretreatment serum interferon-?-inducible protein-10 improves the predictive value of an IL28B gene polymorphism for hepatitis C treatment response.
21254157 2011 Role of interleukin-28B polymorphisms in the treatment of hepatitis C virus genotype 2 infection in Asian patients.
21147186 2011 Impact of donor and recipient IL28B rs12979860 genotypes on hepatitis C virus liver graft reinfection.
21146242 2011 IL-28B rs12979860 C/T allele distribution in patients with liver cirrhosis: role in the course of chronic viral hepatitis and the development of HCC.
21145813 2011 Interferon-lambda serum levels in hepatitis C.
21145800 2011 IL28 variation affects expression of interferon stimulated genes and peg-interferon and ribavirin therapy.
21133812 2011 IL28B polymorphism is associated with both side effects and clearance of hepatitis C during interferon-alpha therapy.
21129805 2011 Pre-treatment prediction of response to pegylated-interferon plus ribavirin for chronic hepatitis C using genetic polymorphism in IL28B and viral factors.
21112660 2011 Predictive value of the IL28B polymorphism on the effect of interferon therapy in chronic hepatitis C patients with genotypes 2a and 2b.
21112657 2011 Importance of IL28B gene polymorphisms in hepatitis C virus genotype 2 and 3 infected patients.
21111740 2011 Interferon-induced gene expression is a stronger predictor of treatment response than IL28B genotype in patients with hepatitis C.
21080244 2011 The IL-28 genotype: how it will affect the care of patients with hepatitis C virus infection.
21070502 2011 Interleukin-28B polymorphisms are associated with hepatitis C virus clearance and viral load in a HIV-1-infected cohort.
21068134 2011 HCV substitutions and IL28B polymorphisms on outcome of peg-interferon plus ribavirin combination therapy.
21048934 2010 IL28B SNP rs8099917 is strongly associated with pegylated interferon-? and ribavirin therapy treatment failure in HCV/HIV-1 coinfected patients.
21038423 2010 Observed and calculated interleukin-28B genotype frequencies in hepatitis C virus infection.
20977343 2010 IL28B polymorphism does not determine outcomes of hepatitis B virus or HIV infection.
20964522 2010 Modeling the probability of sustained virological response to therapy with pegylated interferon plus ribavirin in patients coinfected with hepatitis C virus and HIV.
20950615 2010 IL28B and the control of hepatitis C virus infection.
20931559 2010 IL28B genotype is associated with differential expression of intrahepatic interferon-stimulated genes in patients with chronic hepatitis C.
20924369 2011 IL28B genomic-based treatment paradigms for patients with chronic hepatitis C infection: the future of personalized HCV therapies.
20890887 2010 Hepatitis C trials that combine investigational agents with pegylated interferon should be stratified by interleukin-28B genotype.
20889274 2010 IL28B polymorphisms and chronic hepatitis C.
20887330 2010 High sensitivity assay using serum sample for IL28B genotyping to predict treatment response in chronic hepatitis C patients.
20804372 2010 Prediction of response to pegylated interferon plus ribavirin by IL28B gene variation in patients coinfected with HIV and hepatitis C virus.
20803561 2010 Potential role for interleukin-28B genotype in treatment decision-making in recent hepatitis C virus infection.
20728570 2011 Impact of IL28B genotype on the early and sustained virologic response in treatment-naïve patients with chronic hepatitis C.
20723035 2011 The role of bile acid retention and a common polymorphism in the ABCB11 gene as host factors affecting antiviral treatment response in chronic hepatitis C.
20712453 2010 Interferon-lambda: a new addition to an old family.
20708617 2010 Variants in IL28B in liver recipients and donors correlate with response to peg-interferon and ribavirin therapy for recurrent hepatitis C.
20659305 2011 A tetra-primer amplification refractory mutation system polymerase chain reaction for the evaluation of rs12979860 IL28B genotype.
20648473 2010 Amino acid substitution in hepatitis C virus core region and genetic variation near the interleukin 28B gene predict viral response to telaprevir with peginterferon and ribavirin.
20637200 2010 A polymorphism near IL28B is associated with spontaneous clearance of acute hepatitis C virus and jaundice.
20621700 2010 An IL28B polymorphism determines treatment response of hepatitis C virus genotype 2 or 3 patients who do not achieve a rapid virologic response.
20578254 2010 Interleukin-28B genetic variants and hepatitis virus infection by different viral genotypes.
20576307 2010 Common variation of IL28 affects gamma-GTP levels and inflammation of the liver in chronically infected hepatitis C virus patients.
20455677 2010 Impact of IL-28B SNPs on control of hepatitis C virus infection: a genome-wide association study.
20434452 2010 Hepatic ISG expression is associated with genetic variation in interleukin 28B and the outcome of IFN therapy for chronic hepatitis C.
20399780 2010 Interleukin-28B polymorphism improves viral kinetics and is the strongest pretreatment predictor of sustained virologic response in genotype 1 hepatitis C virus.
20389235 2010 Association of a single nucleotide polymorphism near the interleukin-28B gene with response to hepatitis C therapy in HIV/hepatitis C virus-coinfected patients.
20346265 2010 [IL28 (interferon lambda3) gene polymorphisms and response to IFN-alpha treatment in patients infected with hepatitis virus C].
20235331 2010 Interferon-lambda genotype and low serum low-density lipoprotein cholesterol levels in patients with chronic hepatitis C infection.
20176026 2010 Replicated association between an IL28B gene variant and a sustained response to pegylated interferon and ribavirin.
20060832 2010 Genetic variation in IL28B is associated with chronic hepatitis C and treatment failure: a genome-wide association study.
19759533 2009 Genetic variation in IL28B and spontaneous clearance of hepatitis C virus.
19749758 2009 IL28B is associated with response to chronic hepatitis C interferon-alpha and ribavirin therapy.
19749757 2009 Genome-wide association of IL28B with response to pegylated interferon-alpha and ribavirin therapy for chronic hepatitis C.
19684573 2009 Genetic variation in IL28B predicts hepatitis C treatment-induced viral clearance.
19457860 2009 Interferon-lambda is functionally an interferon but structurally related to the interleukin-10 family.
19304895 2009 Interferon-lambdas: the modulators of antivirus, antitumor, and immune responses.
18987645 2009 Human interferon-lambda3 is a potent member of the type III interferon family.
16618774 2006 Characterization of the mouse IFN-lambda ligand-receptor system: IFN-lambdas exhibit antitumor activity against B16 melanoma.
16539846 2006 Liposome-mediated IL-28 and IL-29 expression in A549 cells and anti-viral effect of IL-28 and IL-29 on WISH cells.
16478884 2006 Interferon-lambda-treated dendritic cells specifically induce proliferation of FOXP3-expressing suppressor T cells.
16413080 2006 Purification and characterization of recombinant human interleukin-29 expressed in Escherichia coli.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
12483210 2003 IFN-lambdas mediate antiviral protection through a distinct class II cytokine receptor complex.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12469119 2003 IL-28, IL-29 and their class II cytokine receptor IL-28R.