Property Summary

NCBI Gene PubMed Count 97
PubMed Score 96.10
PubTator Score 28.81

Knowledge Summary

Patent

No data available

TINX Plot

Gene RIF (90)

AA Sequence

MAAAWTVVLVTLVLGLAVAGPVPTSKPTTTGKGCHIGRFKSLSPQELASFKKARDALEESLKLKNWSCSS      1 - 70
PVFPGNWDLRLLQVRERPVALEAELALTLKVLEAAAGPALEDVLDQPLHTLHHILSQLQACIQPQPTAGP     71 - 140
RPRGRLHHWLHRLQEAPKKESAGCLEASVTFNLFRLLTRDLKYVADGNLCLRTSTHPEST              141 - 200
//

Text Mined References (100)

PMID Year Title