Property Summary

NCBI Gene PubMed Count 19
PubMed Score 19.08
PubTator Score 20.98

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
FTDALS1 3 4.051 2.0

Expression

Gene RIF (12)

PMID Text
26491169 These results suggest that high-risk human papillomavirus 31 target interferon kappa to prevent Sp100 expression and identify Sp100 as an interferon-stimulated gene with anti-human papillomavirus activity.
24614210 This study demonstrates that E2 proteins of high risk human papillomavirus reduce STING and IFN-kappa transcription.
21849431 The viral E6 and E7 oncogenes are sufficient for interferon-kappa repression, with E6 being mainly responsible.
20706608 Studied IFNK single nucleotide polymorphisms in 3982 Systemic lupus erythematosus cases and 4275 controls.
20706608 Observational study of gene-disease association. (HuGE Navigator)
20634891 Observational study of gene-disease association. (HuGE Navigator)
20588308 Observational study of gene-disease association. (HuGE Navigator)
20574843 Observational study of gene-disease association. (HuGE Navigator)
20479716 IFN-kappa is down-regulated in cervical keratinocytes harboring HPV, which may be a contributing factor in the progression of a cervical lesion
19887612 This is the first report showing an epigenetic silencing of type I IFN after HPV16 oncogene expression
18615156 Observational study and genome-wide association study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
12391192 IFN-kappa is able to directly modulate cytokine release from monocytes and dendritic cells, inhibit inducible IL-12 release from monocytes, and bind strongly to heparin.

AA Sequence

MSTKPDMIQKCLWLEILMGIFIAGTLSLDCNLLNVHLRRVTWQNLRHLSSMSNSFPVECLRENIAFELPQ      1 - 70
EFLQYTQPMKRDIKKAFYEMSLQAFNIFSQHTFKYWKERHLKQIQIGLDQQAEYLNQCLEEDKNENEDMK     71 - 140
EMKENEMKPSEARVPQLSSLELRRYFHRIDNFLKEKKYSDCAWEIVRVEIRRCLYYFYKFTALFRRK       141 - 207
//

Text Mined References (19)

PMID Year Title
26491169 2015 Interferon Kappa Inhibits Human Papillomavirus 31 Transcription by Inducing Sp100 Proteins.
24614210 2014 E2 proteins of high risk human papillomaviruses down-modulate STING and IFN-? transcription in keratinocytes.
23376709 2013 A 2-stage genome-wide association study to identify single nucleotide polymorphisms associated with development of urinary symptoms after radiotherapy for prostate cancer.
21849431 2011 High-risk human papillomaviruses repress constitutive kappa interferon transcription via E6 to prevent pathogen recognition receptor and antiviral-gene expression.
20801718 2010 Chromosome 9p21 in amyotrophic lateral sclerosis in Finland: a genome-wide association study.
20706608 2010 The role of genetic variation near interferon-kappa in systemic lupus erythematosus.
20694011 2010 Association of IFIH1 and other autoimmunity risk alleles with selective IgA deficiency.
20634891 2010 Maternal genes and facial clefts in offspring: a comprehensive search for genetic associations in two population-based cleft studies from Scandinavia.
20588308 2010 Dengue hemorrhagic fever is associated with polymorphisms in JAK1.
20574843 2010 Associations of 9p21 variants with cutaneous malignant melanoma, nevi, and pigmentation phenotypes in melanoma-prone families with and without CDKN2A mutations.
20479716 2010 IFN-?, a novel type I IFN, is undetectable in HPV-positive human cervical keratinocytes.
19887612 2009 Epigenetic silencing of interferon-kappa in human papillomavirus type 16-positive cells.
19734901 2009 Genome-wide association study identifies 19p13.3 (UNC13A) and 9p21.2 as susceptibility loci for sporadic amyotrophic lateral sclerosis.
18615156 Genome-wide association scan identifies candidate polymorphisms associated with differential response to anti-TNF treatment in rheumatoid arthritis.
15340161 2004 Signal peptide prediction based on analysis of experimentally verified cleavage sites.
15164053 2004 DNA sequence and analysis of human chromosome 9.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12391192 2002 Regulatory effect of IFN-kappa, a novel type I IFN, on cytokine production by cells of the innate immune system.
11514542 2001 Interferon-kappa, a novel type I interferon expressed in human keratinocytes.