Property Summary

NCBI Gene PubMed Count 86
PubMed Score 41.78
PubTator Score 184.15

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Expression

  Differential Expression (4)

Disease log2 FC p
osteosarcoma 1.057 7.6e-04
glioblastoma 1.100 6.4e-04
Multiple Sclerosis 1.300 4.3e-04
pituitary cancer -1.100 2.3e-07

Gene RIF (73)

PMID Text
26601495 The variability of potentially important functional polymorphic variants of the IFNG, IFNGR2 and NEIL2 genes was characterized in representatives of four ethnic groups living in the Siberian region.
25815589 Statistical analyses revealed that four genetic variants in IFNGR1 were marginally associated with the risk of Tuberculosis (P = 0.02-0.04), while other single nucleotide polymorphisms in IFNGR1 and IFNGR2 did not exhibit any associations
25708927 The expression of IFNGR2 was significantly higher in patients with RA compared with control subjects and was significantly higher in patients in whom radiographic damage was more severe.
25592983 Fatal hemophagocytic lymphohistiocytosis has been described in two unrelated pediatric patients with underlying IFNGR2 deficiency.
25301852 This is the first study that shows an association between SNPs and liver fibrosis in the general population
23980639 It related to persistence of hepatitis B virus (HBV) infection and viral load in chronic HBV.
23963039 We report a molecular study of the two known patients with autosomal recessive, partial interferon-gamma receptor (IFN-gammaR)2 deficiency
23459074 IFN-gammaR2-deficient monocytes induce a higher percentage of IL-17(+) cells from both healthy and IFN-gammaR2-deficient CD4(+) T cells.
23161749 IFNGR2 haploinsufficiency may underlie clinical tuberculosis in children living in areas of endemic disease.
22219326 JAK2 is a critical factor that stabilizes IFN-gammaR2 surface expression in Th17 cells from AMS patients, making them sensitive to IFN-gamma.
22057826 We conclude that the polymorphisms of IFNGR2 may confer resistance to the TB development of newly infected individuals
20980339 HBV viraemia appears to have substantial heritability and polymorphisms in the IFNGR2 gene appear to be associated with the variability of viraemia.
20980339 Observational study of gene-disease association. (HuGE Navigator)
20959405 Observational study of gene-disease association. (HuGE Navigator)
20952689 Observational study of gene-disease association. (HuGE Navigator)
20709103 Data indicate that perturbation of IFN-gammaR2 internalization by mutating the LI(255-256) motif induces a timely coordinated activation of IFN-gamma/STAT1 signaling pathways that leads to the apoptosis of T cells.
20673868 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20588308 Observational study of gene-disease association. (HuGE Navigator)
20587546 between the two IFNg receptors, IFNgR2 expression appears to be the deciding factor that controls the way in which target cells physiologically respond to IFNgamma.
20587546 Observational study of gene-disease association. (HuGE Navigator)
20554027 These results suggesedt that the microglial and oligodendrocytic expression levels of IFN-gamma-R2 are much lower than the astrocytic expression levels in the human CNS.
20503287 Observational study of gene-disease association. (HuGE Navigator)
20453000 Observational study of gene-disease association. (HuGE Navigator)
20452482 Observational study of gene-disease association. (HuGE Navigator)
20378664 Observational study of gene-disease association. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
20039824 The existence of abnormalities in the intracellular processing and protein expression of the IFN-gamma R2 in response to specific stimuli such as IFN-gamma and M. leprae membrane proteins in adherent cells of LL patients.
19948975 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and genetic testing. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19789190 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
19692168 Observational study of gene-disease association. (HuGE Navigator)
19657228 Results show that the discovery of the anti-Bax activity of the cytoplasmic domain of IFNgammaR2 may shed new light on the mechanism of how cell death is controlled by IFNgamma and Bax.
19625176 Observational study of gene-disease association. (HuGE Navigator)
19505916 Observational study of gene-disease association. (HuGE Navigator)
19269302 No significant change was demonstrated in the expression of IFN-gamma receptor beta-chain on surfaces of alveolar macrophages acquired from smokers.
19258923 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19247692 Observational study of gene-disease association. (HuGE Navigator)
19172849 the transcriptional of IFNgRb/IFNgRa in the heart bioptates appeared to be an early and sensitive marker of inflammatory status of patients with myocarditis
19170196 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19141860 Observational study of gene-disease association. (HuGE Navigator)
19012493 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18676680 Observational study of gene-disease association. (HuGE Navigator)
18633131 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18620489 with progression of HIV-1 infection, interferon-gamma production declines whereas expression of interferon-gamma receptors (R1 and R2) increases
18249187 Therefore, our results suggest that the interaction between Sirt2 and 14-3-3 beta/gamma is a novel mechanism for the negative regulation of p53 beside the well-characterized Mdm2-mediated repression.
17703412 Observational study of gene-disease association. (HuGE Navigator)
17697357 expressed IFNgamma and IFNgamma-Ralpha together with the nuclear localization of IFNgamma-Rbeta, could be a tumoral cell response
17618444 Observational study of gene-disease association. (HuGE Navigator)
17618444 IFNGR polymorphisms (Val14Met and Gln64Arg) are protective in systemic lupus erythematosus in Chinese patients
17546485 Variation in transcriptional activity of genes encoding INF-gamma receptor subunits may affect function of microvasculature and thereby participate in the pathology of cardiac syndrome X
17220333 Observational study of gene-disease association. (HuGE Navigator)
16944293 Observational study of gene-disease association. (HuGE Navigator)
16944293 no statistically significant association with susceptibility to persistent HBV infection was observed with the IFN-gamma, IFNGR-1 and 2, and IRF-1 gene polymorphisms under the codominant, dominant, and recessive models
16885196 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16885196 Single Nucleotide Polymorphisms in IFNGR2 is associated with gastric cancer
16867043 Observational study of gene-disease association. (HuGE Navigator)
16690980 Observational study of gene-disease association. (HuGE Navigator)
16467883 interferon-gamma (IFN-gamma) receptor
16467876 Two IFN-gammaR2 chains interact through species-specific determinants in their extracellular domains. Finally, these determinants also participate in the interaction of IFN-gammaR2 with IFN-gammaR1.
16115485 Observational study of gene-disease association. (HuGE Navigator)
16115485 IFNG T874A, IFNGR1 C-56T and IFNGR2 A839G genotypes were not associated with the incidence of angiographic and clinical restenosis (P>0.23).
15979955 Higher frequency of +874T interferon gamma, both in hetero and in homozygosis and mostly whether simultaneous, plays a role in predisposing to gluten intolerance and an increased risk for coeliac disease.
15952126 The IFN-GammaR2 Arg64/Arg64 genotype does not determine susceptibility to SLE in Chinese people, and the combination of IFN-Gamma R2 Arg64/Arg64 genotype and IFN-Gamma R1 Val14/Val14 genotype does not, either.
15952126 Observational study of gene-disease association. (HuGE Navigator)
15585559 In pre eclampsia IFN-gamma R2 protein expression mimicked that in early placental development.
15182327 Observational study of gene-disease association. (HuGE Navigator)
15103018 The mRNA expression levels for alpha-tubulin, TRADD, IFN-gamma R2, GAS1, MADD, NF-kappaB, I-kappa B, 14-3-3 protein, APaf1, PARP, IGF-1 receptor, RB1, Rb2/p130, ARC, and caspase 6 are upregulated in human neuronal cells after treatment with HIV-1 gp120
15004750 Observational study of gene-disease association. (HuGE Navigator)
14651967 Phages displaying fusion proteins with full-length PNRC2 (proline-rich nuclear receptor co-regulatory protein 2), already shown to be a cofactor for other nuclear receptors, and with a polypeptide of the bHLH corepressor TLE1 bound to AF-1.
12420205 Observational study of gene-disease association. (HuGE Navigator)
12020266 Observational study of gene-disease association. (HuGE Navigator)
11240951 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MRPTLLWSLLLLLGVFAAAAAAPPDPLSQLPAPQHPKIRLYNAEQVLSWEPVALSNSTRPVVYQVQFKYT      1 - 70
DSKWFTADIMSIGVNCTQITATECDFTAASPSAGFPMDFNVTLRLRAELGALHSAWVTMPWFQHYRNVTV     71 - 140
GPPENIEVTPGEGSLIIRFSSPFDIADTSTAFFCYYVHYWEKGGIQQVKGPFRSNSISLDNLKPSRVYCL    141 - 210
QVQAQLLWNKSNIFRVGHLSNISCYETMADASTELQQVILISVGTFSLLSVLAGACFFLVLKYRGLIKYW    211 - 280
FHTPPSIPLQIEEYLKDPTQPILEALDKDSSPKDDVWDSVSIISFPEKEQEDVLQTL                 281 - 337
//

Text Mined References (91)

PMID Year Title
26601495 2015 [Characteristic of the Genetic Variability of Four Polymorphic Variants (rs2069705, rs17880053, rs11126176, and rs804271) in Representative Samples of Indigenous and Alien Populations of Siberia].
25815589 2015 Association study of polymorphisms in interferon-? receptor genes with the risk of pulmonary tuberculosis.
25708927 2015 Expression of Interferon-? Receptor Genes in Peripheral Blood Mononuclear Cells Is Associated With Rheumatoid Arthritis and Its Radiographic Severity in African Americans.
25592983 2015 Hemophagocytic lymphohistiocytosis in 2 patients with underlying IFN-? receptor deficiency.
25301852 2015 Interferon gamma receptor 2 gene variants are associated with liver fibrosis in the general population: the Rotterdam Study.
25201988 2014 Common genetic variants associated with cognitive performance identified using the proxy-phenotype method.
24390342 2014 Genetics of rheumatoid arthritis contributes to biology and drug discovery.
23980639 2014 HLA-DP and ?-interferon receptor-2 gene variants and their association with viral hepatitis activity in chronic hepatitis B infection.
23963039 2013 Partial IFN-?R2 deficiency is due to protein misfolding and can be rescued by inhibitors of glycosylation.
23459074 2013 Influence of a mutation in IFN-? receptor 2 (IFNGR2) in human cells on the generation of Th17 cells in memory T cells.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23161749 2013 Haploinsufficiency at the human IFNGR2 locus contributes to mycobacterial disease.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
22936669 2013 A genome-wide association study on a southern European population identifies a new Crohn's disease susceptibility locus at RBX1-EP300.
22902943 2012 Severe disseminated mycobacterial infection in a boy with a novel mutation leading to IFN-?R2 deficiency.
22634764 2012 Activation of the carbon concentrating mechanism by CO2 deprivation coincides with massive transcriptional restructuring in Chlamydomonas reinhardtii.
22219326 2012 Th17 cells in multiple sclerosis express higher levels of JAK2, which increases their surface expression of IFN-?R2.
22057826 2012 Association of IFNGR2 gene polymorphisms with pulmonary tuberculosis among the Vietnamese.
20980339 2011 Hepatitis B viraemia: its heritability and association with common genetic variation in the interferon gamma signalling pathway.
20959405 2010 The IFNG (IFN-gamma) genotype predicts cytogenetic and molecular response to imatinib therapy in chronic myeloid leukemia.
20952689 2011 Cytokine polymorphisms in Th1/Th2 pathway genes, body mass index, and risk of non-Hodgkin lymphoma.
20709103 2010 Expression of IFN?R2 mutated in a dileucine internalization motif reinstates IFN? signaling and apoptosis in human T lymphocytes.
20673868 2010 A genetic association study of maternal and fetal candidate genes that predispose to preterm prelabor rupture of membranes (PROM).
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20588308 2010 Dengue hemorrhagic fever is associated with polymorphisms in JAK1.
20587546 2010 Interferon gamma receptor 2 gene variants are associated with liver fibrosis in patients with chronic hepatitis C infection.
20554027 2010 Differential expression of interferon-gamma receptor on human glial cells in vivo and in vitro.
20503287 2010 Interleukin-9 polymorphism in infants with respiratory syncytial virus infection: an opposite effect in boys and girls.
20453000 2010 A Large-scale genetic association study of esophageal adenocarcinoma risk.
20452482 2010 Identification of fetal and maternal single nucleotide polymorphisms in candidate genes that predispose to spontaneous preterm labor with intact membranes.
20378664 2010 Analysis of multiple candidate genes in association with phenotypes of multiple sclerosis.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20039824 2010 Abnormalities in intracellular processing and expression of interferon-gamma receptor in adherent cells from lepromatous leprosy patients.
19948975 2009 Integrative predictive model of coronary artery calcification in atherosclerosis.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19789190 2009 A gene-based risk score for lung cancer susceptibility in smokers and ex-smokers.
19692168 2010 Genetic susceptibility to distinct bladder cancer subphenotypes.
19657228 2009 The C-terminus of interferon gamma receptor beta chain (IFNgammaR2) has antiapoptotic activity as a Bax inhibitor.
19625176 2009 PTEN identified as important risk factor of chronic obstructive pulmonary disease.
19505916 2009 Cytokine and cytokine receptor single-nucleotide polymorphisms predict risk for non-small cell lung cancer among women.
19269302 2009 Down modulation of IFN-gamma signaling in alveolar macrophages isolated from smokers.
19258923 2009 Genetic susceptibility to respiratory syncytial virus bronchiolitis in preterm children is associated with airway remodeling genes and innate immune genes.
19247692 2009 Analyses of associations with asthma in four asthma population samples from Canada and Australia.
19172849 Transcriptional activity of interferon gamma and two subunits of its receptor as molecular markers of myocarditis.
19170196 2009 Polymorphisms in innate immunity genes and lung cancer risk in Xuanwei, China.
19141860 2009 Genetic variants in the candidate genes of the apoptosis pathway and susceptibility to chronic myeloid leukemia.
19012493 2009 Common variants in immune and DNA repair genes and risk for human papillomavirus persistence and progression to cervical cancer.
18676680 2008 Pathway-based evaluation of 380 candidate genes and lung cancer susceptibility suggests the importance of the cell cycle pathway.
18633131 2008 Host immune gene polymorphisms in combination with clinical and demographic factors predict late survival in diffuse large B-cell lymphoma patients in the pre-rituximab era.
18620489 2008 Interferon-gamma receptors in HIV-1 infection.
18249187 2008 Sirt2 interacts with 14-3-3 beta/gamma and down-regulates the activity of p53.
17703412 2007 Genetic susceptibility to respiratory syncytial virus bronchiolitis is predominantly associated with innate immune genes.
17697357 2007 Influence of IFN-gamma and its receptors in human breast cancer.
17618444 2007 The interferon-gamma receptor gene polymorphisms (Val14Met and Gln64Arg) are not associated with systemic lupus erythematosus in Chinese patients.
17546485 2007 Transcriptional activity of genes encoding interferon gamma (IFNgamma) and its receptor assessed in peripheral blood mononuclear cells in patients with cardiac syndrome X.
17220333 2007 A case-control investigation of immune function gene polymorphisms and risk of testicular germ cell tumors.
16944293 2006 Genetic polymorphism of interferon-gamma, interferon-gamma receptor, and interferon regulatory factor-1 genes in patients with hepatitis B virus infection.
16885196 2007 Polymorphisms in Th1-type cell-mediated response genes and risk of gastric cancer.
16867043 2006 IL-10 promoter and IL4-Ralpha gene SNPs are associated with immediate beta-lactam allergy in atopic women.
16780588 2006 Cell array-based intracellular localization screening reveals novel functional features of human chromosome 21 proteins.
16690980 2006 Polymorphism within the interferon-gamma/receptor complex is associated with pulmonary tuberculosis.
16467883 2006 Modulation of the activation of Stat1 by the interferon-gamma receptor complex.
16467876 2006 Preassembly and ligand-induced restructuring of the chains of the IFN-gamma receptor complex: the roles of Jak kinases, Stat1 and the receptor chains.
16115485 2005 Interferon-gamma and interferon-gamma receptor 1 and 2 gene polymorphisms and restenosis following coronary stenting.
15979955 2005 TNFalpha, IFNgamma and IL-10 gene polymorphisms in a sample of Sicilian patients with coeliac disease.
15952126 2005 [Polymorphisms within the interferon-Gamma receptor associated with systemic lupus erythematosus].
15924140 2005 Gains of glycosylation comprise an unexpectedly large group of pathogenic mutations.
15585559 2005 Placental expression of interferon-gamma (IFN-gamma) and its receptor IFN-gamma R2 fail to switch from early hypoxic to late normotensive development in preeclampsia.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15356148 2004 Characterization of a dipeptide motif regulating IFN-gamma receptor 2 plasma membrane accumulation and IFN-gamma responsiveness.
15182327 2004 Polymorphisms in the genes encoding interferon-gamma and interferon-gamma receptors in multiple sclerosis.
15004750 2004 Association between IFNA genotype and the risk of sarcoidosis.
14651967 2003 Identification of PNRC2 and TLE1 as activation function-1 cofactors of the orphan nuclear receptor ERRgamma.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12420205 2002 Polymorphisms of transforming growth factor-beta1 and transforming growth factor-beta1 type II receptor genes are associated with acute graft-versus-host disease in children with HLA-matched sibling bone marrow transplantation.
12020266 2002 Contribution of the interleukin 4 gene to susceptibility to subacute sclerosing panencephalitis.
11679576 2001 hTid-1, a human DnaJ protein, modulates the interferon signaling pathway.
11585785 2001 Antiviral actions of interferons.
11240951 2001 Association of IFN-gamma and IFN regulatory factor 1 polymorphisms with childhood atopic asthma.
10830953 2000 The DNA sequence of human chromosome 21.
10608793 2000 Partial interferon-gamma receptor signaling chain deficiency in a patient with bacille Calmette-Guérin and Mycobacterium abscessus infection.
10605012 2000 Surface expression of the IFN-gamma R2 chain is regulated by intracellular trafficking in human T lymphocytes.
9616207 1998 Mutation in the signal-transducing chain of the interferon-gamma receptor and susceptibility to mycobacterial infection.
8910544 1996 The structure of the gene for the second chain of the human interferon-gamma receptor.
8631301 1996 Kinase-negative mutants of JAK1 can sustain interferon-gamma-inducible gene expression but not an antiviral state.
8124716 1994 Identification and sequence of an accessory factor required for activation of the human interferon gamma receptor.
7673114 1995 Interaction between the components of the interferon gamma receptor complex.
7615558 1995 The Jak kinases differentially associate with the alpha and beta (accessory factor) chains of the interferon gamma receptor to form a functional receptor unit capable of activating STAT transcription factors.
7514165 1994 Interferon-gamma induces tyrosine phosphorylation of interferon-gamma receptor and regulated association of protein tyrosine kinases, Jak1 and Jak2, with its receptor.
3136170 1988 Molecular and biochemical characterization of a novel gamma-interferon-inducible protein.
2141727 1990 Sublocalization on chromosome 21 of human interferon-alpha receptor gene and the gene for an interferon-gamma response protein.