Property Summary

NCBI Gene PubMed Count 18
PubMed Score 41.06
PubTator Score 35.02

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Osteogenesis imperfecta, type 5 1 0.0 0.0
Disease Target Count
Osteogenesis Imperfecta, Type V 1
Disease Target Count Z-score Confidence
Osteogenesis imperfecta 34 6.583 3.3
Disease Target Count Z-score Confidence
Dentinogenesis imperfecta 25 4.738 2.4
Bruck syndrome 10 3.501 1.8
Disease Target Count
Osteogenesis imperfecta type 5 2

Expression

Gene RIF (9)

AA Sequence

MDTAYPREDTRAPTPSKAGAHTALTLGAPHPPPRDHLIWSVFSTLYLNLCCLGFLALAYSIKARDQKVVG      1 - 70
DLEAARRFGSKAKCYNILAAMWTLVPPLLLLGLVVTGALHLARLAKDSAAFFSTKFDDADYD             71 - 132
//

Text Mined References (20)

PMID Year Title