Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.32
PubTator Score 0.24

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
Breast cancer 2.900 2.7e-02
intraductal papillary-mucinous neoplasm ... 1.200 3.2e-02
lung adenocarcinoma 1.700 3.8e-09
osteosarcoma 1.787 2.2e-04
ovarian cancer 1.600 3.1e-04
pancreatic cancer 1.400 2.8e-03
primary pancreatic ductal adenocarcinoma 1.698 4.5e-04

 Compartment GO Term (1)

AA Sequence

MECALDAQSLISISLRKIHSSRTQRGGIKLHKNLLVSYVLRNARQLYLSERYAELYRRQQQQQQQQPPHH      1 - 70
QHQHLAYAAPGMPASAADFGPLQLGGGGDAEAREPAARHQLHQLHQLHQLHLQQQLHQHQHPAPRGCAAA     71 - 140
AAAGAPAGGAGALSELPGCAALQPPHGAPHRGQPLEPLQPGPAPLPLPLPPPAPAALCPRDPRAPAACSA    141 - 210
PPGAAPPAAAASPPASPAPASSPGFYRGAYPTPSDFGLHCSSQTTVLDLDTHVVTTVENGYLHQDCCASA    211 - 280
HCPCCGQGAPGPGLASAAGCKRKYYPGQEEEEDDEEDAGGLGAEPPGGAPFAPCKRARFEDFCPDSSPDA    281 - 350
SNISNLISIFGSGFSGLVSRQPDSSEQPPPLNGQLCAKQALASLGAWTRAIVAF                    351 - 404
//

Text Mined References (6)

PMID Year Title