Property Summary

NCBI Gene PubMed Count 6
PubMed Score 9.27
PubTator Score 2.06

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (4)

Disease log2 FC p
osteosarcoma -1.473 1.1e-04
adrenocortical carcinoma -1.129 6.5e-09
non-small cell lung cancer -1.043 8.5e-16
posterior fossa group B ependymoma 1.200 1.9e-09

Synonym

Accession Q5T6J7 A5PLN6 Q5T6J6
Symbols hGntK
C9orf103
bA522I20.2

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (1)

PMID Text
23067238 Data show that C9orf103 encodes a functional gluconokinase.

AA Sequence

MAAPGALLVMGVSGSGKSTVGALLASELGWKFYDADDYHPEENRRKMGKGIPLNDQDRIPWLCNLHDILL      1 - 70
RDVASGQRVVLACSALKKTYRDILTQGKDGVALKCEESGKEAKQAEMQLLVVHLSGSFEVISGRLLKREG     71 - 140
HFMPPELLQSQFETLEPPAAPENFIQISVDKNVSEIIATIMETLKMK                           141 - 187
//

Text Mined References (10)

PMID Year Title
26505675 2015 Kinetic analysis of gluconate phosphorylation by human gluconokinase using isothermal titration calorimetry.
24896608 2014 Biochemical characterization of human gluconokinase and the proposed metabolic impact of gluconic acid as determined by constraint based metabolic network analysis.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23067238 2013 Inferring the metabolism of human orphan metabolites from their metabolic network context affirms human gluconokinase activity.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
16015647 2005 Delineation of the minimal commonly deleted segment and identification of candidate tumor-suppressor genes in del(9q) acute myeloid leukemia.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.