Property Summary

NCBI Gene PubMed Count 162
PubMed Score 384.23
PubTator Score 438.05

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.176 2.7e-03
psoriasis 1.500 1.4e-05
osteosarcoma -1.147 2.2e-03
ependymoma 1.100 7.3e-10
atypical teratoid / rhabdoid tumor 1.500 2.3e-06
glioblastoma 1.200 1.9e-04
medulloblastoma, large-cell 1.600 1.3e-05
Atopic dermatitis -1.100 1.8e-04
non-small cell lung cancer 1.306 5.1e-18
lung cancer 1.300 3.9e-02
invasive ductal carcinoma 1.100 8.3e-04
ovarian cancer 2.200 2.7e-06

MLP Assay (15)

AID Type Active / Inconclusive / Inactive Description
434962 screening 1316 / 0 / 323542 Fluorescence polarization-based cell-based primary high throughput screening assay to identify inhibitors of insulin-degrading enzyme (IDE)
434984 summary 0 / 0 / 0 Summary of probe development efforts to identify inhibitors of insulin-degrading enzyme (IDE)
435028 screening 598 / 0 / 581 Fluorescence polarization-based cell-based high throughput confirmation assay for inhibitors of insulin-degrading enzyme (IDE)
463220 confirmatory 44 / 0 / 83 Dose Response: Fluorescence polarization-based cell-based high throughput dose response assay for inhibitors of insulin-degrading enzyme (IDE)
493087 screening 245 / 0 / 335216 Fluorescence polarization-based cell-based primary high throughput screening assay to identify activators of insulin-degrading enzyme (IDE)
493124 summary 0 / 0 / 0 Summary of probe development efforts to identify activators of insulin-degrading enzyme (IDE)
588439 confirmatory 32 / 0 / 199 Fluorescence polarization-based cell-based high throughput dose response assay to identify activators of insulin-degrading enzyme (IDE)
588681 confirmatory 18 / 0 / 213 Counterscreen for IDE activators: Fluorescence polarization-based biochemical high throughput dose response assay for activators of recombinant IDE
588711 confirmatory 9 / 0 / 23 Late stage counterscreen assay for the probe development effort to identify inhibitors of insulin-degrading enzyme (IDE): Fluorescence polarization-based biochemical dose response assay for inhibitors of recombinant IDE
588712 confirmatory 7 / 0 / 25 Late stage assay for the probe development effort to identify inhibitors of insulin-degrading enzyme (IDE): Fluorescence polarization-based cell-based dose response assay for inhibitors of IDE
More...

Gene RIF (156)

PMID Text
26186340 the mechanistic and molecular features of IDE-26S proteasome interaction in a cell experimental model, is reported.
25414272 results demonstrate that the polymorphisms rs1887922 and rs1999764 of the IDE gene are associated with late-onset Alzheimer disease susceptibility in the Xinjiang Han population
25105907 No significant associations have been found between other IDE gene single nucleotide polymorphisms of rs4646953, rs2251101 and rs1544210 with Alzheimer disease.
24516642 IDE does not play a major role in MHC class I antigen processing, confirming the dominant and almost exclusive role of the proteasome in cytosolic production of MHC class I ligands.
24477584 Our study provided evidence to IDE, PON1, WFS1, POU2F1, IL1alpha and IL1beta associated with T2D in Pakistanis.
24355596 Cognitive impairment is more frequent among those exposed to the C allele of the rs2209972 SNP of the insulin degrading enzyme gene.
24059301 using combinational in silico investigations, study identified that pathogenic nonsynonymous mutations corresponding to p.I54F, p.P122T, p.T533R, p.P581A and p.Y609A have more potential role in structural and functional deviations of IDE activity
23922390 Conformational changes in IDE, including a swinging-door mechanism that permits the entry of short peptides into the catalytic chamber, governs the selective destruction of amyloidogenic peptides.
23797320 An upstream promoter element which blocks the antisense transcription of the human IDE promoter, was identified.
23597493 Both IDE and type 2 diabetes are associated with executive function levels in older adults
23525105 IDE-Met(1) links the mitochondrial biogenesis pathway with mitAbeta levels and organelle functionality.
23416320 for the rs1832196 polymorphism, significant association with Alzheimer disease was found by the dominant model in overall and subgroup analysis.
23036584 In conclusion, this epistatic interaction showed a high degree of consistency when stratifying by sex, the epsilon4 allele of apolipoprotein E genotype, and geographic region.
22502914 In the context of APOEepsilon4-negative status, insulin-degrading enzyme variants are significantly associated with Alzheimer disease in some genetic models.
22267728 Phosphorylation of amyloid-beta peptide at serine 8 attenuates its clearance via insulin-degrading and angiotensin-converting enzymes.
22107728 The upstream polymorphism IDE2 was found to influence AD risk and to trigger the Abeta42 plasma level, whereas the downstream polymorphism IDE7 modified the T2DM risk; no associations were found for the intronic variant IDE9.
22036964 Data suggest that HEs-1/Hey-1 transcriptional modulation of insulin degrading enzyme may impact amyloid beta metabolism by providing a functional link between Notch signaling and the amyloidogenic pathway.
21992747 Significant differences were found in the response to induced ketosis among non-carriers of putative gain-of-function polymorphisms in rs1143627 and rs16944 in the IL-1beta gene and among variants of the polymorphism rs2251101 in the insulysin gene.
21873424 BRI2 protein regulates beta-amyloid degradation by increasing levels of secreted insulin-degrading enzyme (IDE).
21731745 Five IDE variants for altered in vitro reporter gene expression, based on their presence on haplotypes (H2, H6 and H9) and their association with altered IDE mRNA transcript levels , were tested.
21343292 dimers of insulin-degrading enzyme reveal a cis activation mechanism
21232820 Genetic variants for both insulin degrading enzyme (IDE) and angiotensin converting enzyme (ACE) in relation to cognitive phenotype.
21185309 IDE cleaves ubiquitin in a biphasic manner
21098034 the evolutionarily conserved IDE may play a key role in modulating and reshaping the strength and duration of NP-mediated signaling.
20971110 IIA(Glc) of the sugar phosphotransferase system regulates the peptidase activity of a mammalian insulysin homolog in V. vulnificus.
20927120 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
20880607 The polymorphism of insulin-degrading enzyme is associated with susceptibility to Alzheimer's disease in Han Chinese.
20880607 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20877624 Observational study of gene-disease association. (HuGE Navigator)
20816152 Observational study of gene-disease association. (HuGE Navigator)
20724036 Observational study of gene-disease association. (HuGE Navigator)
20703447 HHEX, IDE and SLC30A8 showed strongest tissue-specific mRNA expression bias and are associated with increased risk of type 2 diabete.
20663017 IDE is not correlated with amyloig beta or clinical diagnosis Alzheimer disease
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20490451 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
20460429 Observational study of gene-disease association. (HuGE Navigator)
20384434 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20380468 In comparison to Abeta40, Abeta42 is more flexible and interacts through a smaller number (17-22) of hydrogen bonds in the catalytic chamber of IDE.
20364150 produce tumor antigenic peptides presented by MHC class I molecules for cytotoxic T lymphocyte recognition
20362553 this study more generally suggests an interplay between RB and IDE within the proteasome that may have important growth-regulatory consequences.
20203524 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20161779 Observational study of gene-disease association. (HuGE Navigator)
20098734 a previously unreported variant unequivocally associated with increased IDE expression was also associated with reduced plasma Abeta40 and decreased LOAD susceptibility
20098734 Observational study of gene-disease association. (HuGE Navigator)
20082125 Results describe the in vitro degradation of insulin-like peptide 3 by insulin-degrading enzyme.
20033747 the catalytic mechanisms for the hydrolysis of the three different peptide bonds of Alzheimer amyloid beta (Abeta) peptide by insulin-degrading enzyme (IDE)
19933996 the same genetic HHEX-IDE variant, which is associated with type 2 diabetes from previous studies, also influences pediatric body mass index
19933996 Observational study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19896952 structural basis of how the high dipole moment of substrates complements the charge distribution of the IDE catalytic chamber for the substrate selectivity
19889475 Observational study of gene-disease association. (HuGE Navigator)
19864659 Here we show that a combination of risk genotypes for NEP and IDE genes leads to a higher susceptibility to AD.
19864659 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19864391 IDE protease binds to the 73-kDa gE precursor and that this event occurs in the cytosol but not as a receptor/ligand interaction.
19862325 there is an association between PPARG, KCNJ11, CDKAL1, CDKN2A-CDKN2B, IDE-KIF11-HHEX, IGF2BP2 and SLC30A8 and type 2 diabetes in the Chinese population
19862325 Observational study of gene-disease association. (HuGE Navigator)
19809796 Study verified associations of two IDE polymorphisms (rs1887922 and rs2149632) with type 2 diabetes risk in two independent German cohorts and evaluated in detail the association of common variants with insulin metabolism and glycemic traits.
19809796 Observational study of gene-disease association. (HuGE Navigator)
19808892 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19808678 Cys-178 has a role in preventing inactivation and oligomerization of human insulin-degrading enzyme by oxidation and nitrosylation
19794065 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19785409 possible mechanism by which the insulin-degrading enzyme (IDE) zinc-binding protease carries out its catalytic function toward two peptides of different length
19741166 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19622614 The association of low birth weight and type 2 diabetes risk alleles of the HHEX-IDE locus is confirmed in children of mothers with type 1 diabetes.
19622614 Observational study of gene-disease association. (HuGE Navigator)
19606063 This study demenostrated that insulin-degrading enzyme levels is increased in Alzheimer disease in relation to disease severity.
19602701 Meta-analysis and HuGE review of gene-disease association. (HuGE Navigator)
19592620 Observational study of gene-disease association. (HuGE Navigator)
19592050 This result suggests that the IDE gene might contribute to metabolic syndrome susceptibility in Chinese elders
19592050 Observational study of gene-disease association. (HuGE Navigator)
19453261 Observational study of gene-disease association. (HuGE Navigator)
19396426 Loss of insulin-induced regulation of IDE activity under hyperglycaemia may contribute to the reduced insulin extraction and peripheral hyperinsulinaemia in type 2 diabetes.
19383491 These results suggest that PPARgamma transcriptionally induces IDE expression.
19321446 IDE forms an enclosed catalytic chamber that completely engulfs and intimately interacts with a partially unfolded insulin molecule.
19239107 Allele and genotype frequency distribution for three markers of insulinase differed only in the sample of females between T2D patients and control , while only in case of rs7078413 SNP genotype frequencies varied significantly in the total population
19239107 Observational study of gene-disease association. (HuGE Navigator)
19228808 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19139842 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19082521 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19053027 Located on chromosome 10 and suscptibility of polymorphisms are related to type 2 diabetes.
19019493 Insulin degrading enzyme is linked with aggregated Abeta40 isoform while neprilysin negatively correlates with amyloid angiopathy.
18996360 present study provides evidence that IDE promoter polymorphisms that significantly decrease IDE expression levels are associated with development of sporadic lzheimer disease
18996360 Observational study of gene-disease association. (HuGE Navigator)
18986166 kinetics and regulation of human IDE with short peptides
18984664 Observational study of gene-disease association. (HuGE Navigator)
18977241 Observational study of gene-disease association. (HuGE Navigator)
18813847 Insulin-degrading enzyme protein expression was found in normal tissues of the kidney, liver, lung, brain, breast and skeletal muscle, as well as in breast and ovarian cancer tissues.
18783335 IDE protein was expressed in all the tissues assessed and all the tumor cell lines except for Raji and HL-60.
18719881 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18633108 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18621727 predict that alkylation of C812 and C819 disrupts substrate binding, whereas alkylation of C178 interferes with the apposition of active-site domains and subtly repositions zinc-binding residues
18618095 Observational study of gene-disease association. (HuGE Navigator)
18591388 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18448515 Results suggest a relationship between a gene that is intimately involved in insulin metabolism and the determination of lifespan in humans.
18426861 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
18411275 the catalytic domain of insulin-degrading enzyme forms a denaturant-resistant complex with amyloid beta peptide
18226493 Importance of the distribution of the enzyme in brain and pituitary is discussed in relation to its main known substrataes.
17971426 Observational study of gene-disease association. (HuGE Navigator)
17971426 Polymorphisms in the IDE-KIF11-HHEX gene locus are associated with susceptibility to type 2 diabetes across the boundary of race.
17964527 This shows that IDE is involved in cellular insulin metabolism and provides further evidence that insulin inhibits protein degradation via an interaction with IDE.
17953957 The single nucleotide polymorphism rs2209972 in the human IDE gene is associated with metabolic features of polycystic ovary syndrome women in a Chinese population.
17953957 Observational study of gene-disease association. (HuGE Navigator)
17913278 Meta-analysis of gene-disease association. (HuGE Navigator)
17913278 Variations in IDE may contribute to diabetes susceptibility in the Korean population.
17827400 Observational study of gene-disease association. (HuGE Navigator)
17804762 Observational study of gene-disease association. (HuGE Navigator)
17601350 Observational study of gene-disease association. (HuGE Navigator)
17579348 Observational study of gene-disease association. (HuGE Navigator)
17496198 Observational study of gene-disease association. (HuGE Navigator)
17496198 SNPs rs4646953 & rs4646955 are associated with Alzheimer disease in Finnish patients, conferring an approximately two-fold increased risk.
17463249 Meta-analysis and genome-wide association study of gene-disease association. (HuGE Navigator)
17293876 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
17244626 the genetic linkage of AD in this set of chromosome 10-linked AD families may be the result of systemic defects in IDE activity in the absence of altered IDE expression
17192785 Meta-analysis of gene-disease association. (HuGE Navigator)
17192720 This study suggests IDE may be indirectly related to dementia via its regulation of insulin levels, but it is not a major gene for Alzheimer's.
17143514 First demonstration of IDE in normal and neoplastic human mammary tissues, providing an experimental starting point towards exploring a potential role of IDE in the control of tumor progression.
17055432 cellular receptor for infection by varicella-zoster virus. Interacts with VZV glycoprotein E.
17051221 protein structures of human IDE in complex with four substrates (insulin B chain, amyloid-beta peptide (1-40), amylin and glucagon)
16914266 Observational study of gene-disease association. (HuGE Navigator)
16876916 Observational study of gene-disease association. (HuGE Navigator)
16876916 The combined genotype data from 1269 late-onset AD cases and 980 controls yielded a significant association to IDE_9 located in the 3'-end of the IDE gene after conservative multiple testing Bonferroni correction (p = 0.005).
16675064 Observational study of gene-disease association. (HuGE Navigator)
16675064 Different reconstructed insulin-degrading enzyme haplotypes were associated with Alzheimers disease and lower cognitive ability.
16574064 IDE-N is the catalytic domain and IDE-C facilitates substrate recognition as well as plays a key role in the oligomerization of IDE.
16511862 Beta-amyloid degradation is largely the result of the action of IDE, as it is blocked by insulin in the medium, a competitive substrate of IDE. IDE could be an important therapeutic target to decrease the amount of Abeta in the cerebrovasculature.
16385451 Observational study of gene-disease association. (HuGE Navigator)
16380485 Observational study of gene-disease association. (HuGE Navigator)
16380485 Common genetic variation at IDE is unlikely to confer clinically significant risk of type 2 diabetes in Caucasians.
15911128 Observational study of gene-disease association. (HuGE Navigator)
15858821 Observational study of gene-disease association. (HuGE Navigator)
15858813 Observational study of gene-disease association. (HuGE Navigator)
15850385 This study systematically characterizes IDE mRNAs, identifies a novel, catalytically inefficient splice form and compares its subcellular distribution, kinetic properties and ability to degrade amyloid beta protein to the known isoform.
15718037 Results indicate that alleles of IDE contribute to variability in A beta deposition in the AD brain and suggest that this relationship may have relevance for the degree of cognitive dysfunction in AD patients.
15590928 To test the hypothesis that insulin might upregulate IDE via a negative feedback control mechanism, we used both in vitro and in vivo strategies to determine the impact of insulin signaling on IDE levels.
15489232 a defect in Abeta proteolysis by IDE contributes to the accumulation of this peptide in the cortical microvasculature
15285718 IDE is targeted to mitochondria via alternative initiation of translation.
15277615 Observational study of gene-disease association. (HuGE Navigator)
15277615 The C allele of single-nucleotide polymorphism IDE2 associated with Alzheimer disease. There may be a possible synergic interaction between IDE & APOE epsilon4.
15277398 Observational study of gene-disease association. (HuGE Navigator)
15277398 Polymorphism in/near IDE contributes to a large proportion of variance in plasma insulin levels and correlated traits.
15181249 IDE gene promoter region variants are associated with AD in subjects without an epsilon4 allele
15088150 Observational study of gene-disease association. (HuGE Navigator)
15088150 genomic region in the proximity of IDE that may contribute to Alzheimer and Parkinson disease in a similar manner.
15024728 Observational study of gene-disease association. (HuGE Navigator)
15024728 This study provides strong evidence for pathogenic variant(s) in the 276-kb region harboring IDE that influence intermediate Alzheimer's disease phenotypes and risk for AD.
14764804 Biochemical characteristics of insulin degradation in wound fluid were consistent with characteristics of insulin-degrading enzyme. Reduction in insulin-degrading activity in wound fluid is potential therapeutic target.
14755451 IDE gene polymorphisms do not confer susceptibility to early- or late-onset AD at least in a Japanese population.
14517947 Observational study of gene-disease association. (HuGE Navigator)
12765971 Observational study of gene-disease association. (HuGE Navigator)
12765971 Polymorphism in this enzyme are associated with NIDDM in men.
12746301 when intracellular long-chain fatty acid concentrations are elevated, they may act directly on insulin-degrading enzyme to decrease insulin metabolism and alter insulin action in intact cells and this mechanism may contribute to insulin resistance
12716770 Observational study of gene-disease association. (HuGE Navigator)
12716770 analysis of over 2,400 samples provides no compelling evidence that variation in IDE contributes to diabetes susceptibility in humans
12634421 IDE knockout mice show significantly elevated levels of blood insulin, brain beta-amyloid, and brain amyloid-precursor protein intracellular domain, providing key in vivo evidence that IDE degrades both extracellular and intracellular peptides.
12161276 Observational study of gene-disease association. (HuGE Navigator)
11809755 Insulin-degrading enzyme rapidly removes the beta-amyloid precursor protein intracellular domain (AICD).

AA Sequence

MRYRLAWLLHPALPSTFRSVLGARLPPPERLCGFQKKTYSKMNNPAIKRIGNHITKSPEDKREYRGLELA      1 - 70
NGIKVLLISDPTTDKSSAALDVHIGSLSDPPNIAGLSHFCEHMLFLGTKKYPKENEYSQFLSEHAGSSNA     71 - 140
FTSGEHTNYYFDVSHEHLEGALDRFAQFFLCPLFDESCKDREVNAVDSEHEKNVMNDAWRLFQLEKATGN    141 - 210
PKHPFSKFGTGNKYTLETRPNQEGIDVRQELLKFHSAYYSSNLMAVCVLGRESLDDLTNLVVKLFSEVEN    211 - 280
KNVPLPEFPEHPFQEEHLKQLYKIVPIKDIRNLYVTFPIPDLQKYYKSNPGHYLGHLIGHEGPGSLLSEL    281 - 350
KSKGWVNTLVGGQKEGARGFMFFIINVDLTEEGLLHVEDIILHMFQYIQKLRAEGPQEWVFQECKDLNAV    351 - 420
AFRFKDKERPRGYTSKIAGILHYYPLEEVLTAEYLLEEFRPDLIEMVLDKLRPENVRVAIVSKSFEGKTD    421 - 490
RTEEWYGTQYKQEAIPDEVIKKWQNADLNGKFKLPTKNEFIPTNFEILPLEKEATPYPALIKDTAMSKLW    491 - 560
FKQDDKFFLPKACLNFEFFSPFAYVDPLHCNMAYLYLELLKDSLNEYAYAAELAGLSYDLQNTIYGMYLS    561 - 630
VKGYNDKQPILLKKIIEKMATFEIDEKRFEIIKEAYMRSLNNFRAEQPHQHAMYYLRLLMTEVAWTKDEL    631 - 700
KEALDDVTLPRLKAFIPQLLSRLHIEALLHGNITKQAALGIMQMVEDTLIEHAHTKPLLPSQLVRYREVQ    701 - 770
LPDRGWFVYQQRNEVHNNCGIEIYYQTDMQSTSENMFLELFCQIISEPCFNTLRTKEQLGYIVFSGPRRA    771 - 840
NGIQGLRFIIQSEKPPHYLESRVEAFLITMEKSIEDMTEEAFQKHIQALAIRRLDKPKKLSAECAKYWGE    841 - 910
IISQQYNFDRDNTEVAYLKTLTKEDIIKFYKEMLAVDAPRRHKVSVHVLAREMDSCPVVGEFPCQNDINL    911 - 980
SQAPALPQPEVIQNMTEFKRGLPLFPLVKPHINFMAAKL                                   981 - 1019
//

Text Mined References (166)

PMID Year Title
26186340 2015 Proteasome Activity Is Affected by Fluctuations in Insulin-Degrading Enzyme Distribution.
25414272 2015 Association between polymorphisms of the insulin-degrading enzyme gene and late-onset Alzheimer disease.
25105907 2015 Association of insulin degrading enzyme gene polymorphisms with Alzheimer's disease: a meta-analysis.
24516642 2014 No major role for insulin-degrading enzyme in antigen presentation by MHC molecules.
24509480 2014 Genome-wide trans-ancestry meta-analysis provides insight into the genetic architecture of type 2 diabetes susceptibility.
24477584 2014 Genetic association of IDE, POU2F1, PON1, IL1? and IL1? with type 2 diabetes in Pakistani population.
24355596 2015 C allele of the rs2209972 single nucleotide polymorphism of the insulin degrading enzyme gene and Alzheimer's disease in type 2 diabetes, a case control study.
24059301 2014 Structural and functional characterization of pathogenic non- synonymous genetic mutations of human insulin-degrading enzyme by in silico methods.
23922390 2013 Conformational states and recognition of amyloidogenic peptides of human insulin-degrading enzyme.
23797320 2013 Transcriptional directionality of the human insulin-degrading enzyme promoter.
23597493 2013 IDE (rs6583817) polymorphism and type 2 diabetes differentially modify executive function in older adults.
23525105 2013 Transcriptional regulation of insulin-degrading enzyme modulates mitochondrial amyloid ? (A?) peptide catabolism and functionality.
23416320 2013 Meta-analysis of the insulin degrading enzyme polymorphisms and susceptibility to Alzheimer's disease.
23036584 2013 Discovery by the Epistasis Project of an epistatic interaction between the GSTM3 gene and the HHEX/IDE/KIF11 locus in the risk of Alzheimer's disease.
22837378 2012 Genome-wide association studies identify CHRNA5/3 and HTR4 in the development of airflow obstruction.
22502914 2012 The association between two single nucleotide polymorphisms within the insulin-degrading enzyme gene and Alzheimer's disease in a Chinese Han population.
22267728 2012 Phosphorylation of amyloid-? peptide at serine 8 attenuates its clearance via insulin-degrading and angiotensin-converting enzymes.
22107728 2011 Disorder-specific effects of polymorphisms at opposing ends of the Insulin Degrading Enzyme gene.
22036964 2012 Notch signaling proteins HES-1 and Hey-1 bind to insulin degrading enzyme (IDE) proximal promoter and repress its transcription and activity: implications for cellular A? metabolism.
21992747 2011 Pharmacogenetic analysis of the effects of polymorphisms in APOE, IDE and IL1B on a ketone body based therapeutic on cognition in mild to moderate Alzheimer's disease; a randomized, double-blind, placebo-controlled study.
21873424 2011 BRI2 protein regulates ?-amyloid degradation by increasing levels of secreted insulin-degrading enzyme (IDE).
21731745 2011 Multiple insulin degrading enzyme variants alter in vitro reporter gene expression.
21343292 2011 Mixed dimers of insulin-degrading enzyme reveal a cis activation mechanism.
21269460 2011 Initial characterization of the human central proteome.
21232820 2012 Cognitive phenotypes in Alzheimer's disease and genetic variants in ACE and IDE.
21185309 2011 Ubiquitin is a novel substrate for human insulin-degrading enzyme.
21098034 2011 Insulin-degrading enzyme modulates the natriuretic peptide-mediated signaling response.
20971110 2010 A mammalian insulysin homolog is regulated by enzyme IIA(Glc) of the glucose transport system in Vibrio vulnificus.
20959807 2010 Polymerization of MIP-1 chemokine (CCL3 and CCL4) and clearance of MIP-1 by insulin-degrading enzyme.
20927120 2010 Variations in/nearby genes coding for JAZF1, TSPAN8/LGR5 and HHEX-IDE and risk of type 2 diabetes in Han Chinese.
20880607 2012 Exploration of 16 candidate genes identifies the association of IDE with Alzheimer's disease in Han Chinese.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20816152 2010 Obesity and diabetes genetic variants associated with gestational weight gain.
20724036 2012 Association between variants in IDE-KIF11-HHEX and plasma amyloid ? levels.
20703447 2010 Expression analysis of loci associated with type 2 diabetes in human tissues.
20663017 2010 Expression and functional profiling of neprilysin, insulin-degrading enzyme, and endothelin-converting enzyme in prospectively studied elderly and Alzheimer's brain.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20581827 2010 Twelve type 2 diabetes susceptibility loci identified through large-scale association analysis.
20490451 2010 Type 2 diabetes risk alleles near ADCY5, CDKAL1 and HHEX-IDE are associated with reduced birthweight.
20460429 2010 BMI at age 8 years is influenced by the type 2 diabetes susceptibility genes HHEX-IDE and CDKAL1.
20384434 2010 Combining genetic markers and clinical risk factors improves the risk assessment of impaired glucose metabolism.
20380468 2010 Elucidation of interactions of Alzheimer amyloid beta peptides (Abeta40 and Abeta42) with insulin degrading enzyme: a molecular dynamics study.
20364150 2010 Production of an antigenic peptide by insulin-degrading enzyme.
20362553 2010 Retinoblastoma protein co-purifies with proteasomal insulin-degrading enzyme: implications for cell proliferation control.
20203524 2010 Genetic susceptibility to type 2 diabetes is associated with reduced prostate cancer risk.
20178365 2010 A proteome-wide perspective on peroxisome targeting signal 1(PTS1)-Pex5p affinities.
20161779 2010 Investigation of type 2 diabetes risk alleles support CDKN2A/B, CDKAL1, and TCF7L2 as susceptibility genes in a Han Chinese cohort.
20098734 2010 Concordant association of insulin degrading enzyme gene (IDE) variants with IDE mRNA, Abeta, and Alzheimer's disease.
20082125 2010 In vitro degradation of insulin-like peptide 3 by insulin-degrading enzyme.
20033747 2010 Elucidation of insulin degrading enzyme catalyzed site specific hydrolytic cleavage of amyloid beta peptide: a comparative density functional theory study.
19933996 2010 Examination of all type 2 diabetes GWAS loci reveals HHEX-IDE as a locus influencing pediatric BMI.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19896952 2010 Molecular basis for the recognition and cleavages of IGF-II, TGF-alpha, and amylin by human insulin-degrading enzyme.
19889475 2011 No replication of genetic association between candidate polymorphisms and Alzheimer's disease.
19864659 2009 Combined risk effects of IDE and NEP gene variants on Alzheimer disease.
19864391 2010 Insulin-degrading enzyme binds to the nonglycosylated precursor of varicella-zoster virus gE protein found in the endoplasmic reticulum.
19862325 2009 PPARG, KCNJ11, CDKAL1, CDKN2A-CDKN2B, IDE-KIF11-HHEX, IGF2BP2 and SLC30A8 are associated with type 2 diabetes in a Chinese population.
19809796 2009 Polymorphisms within insulin-degrading enzyme (IDE) gene determine insulin metabolism and risk of type 2 diabetes.
19808892 2010 Combined risk allele score of eight type 2 diabetes genes is associated with reduced first-phase glucose-stimulated insulin secretion during hyperglycemic clamps.
19808678 2009 Protective role of Cys-178 against the inactivation and oligomerization of human insulin-degrading enzyme by oxidation and nitrosylation.
19794065 2010 Polygenic risk variants for type 2 diabetes susceptibility modify age at diagnosis in monogenic HNF1A diabetes.
19785409 2009 Human insulin-degrading enzyme working mechanism.
19741166 2009 Common genetic determinants of glucose homeostasis in healthy children: the European Youth Heart Study.
19622614 2009 HHEX-IDE polymorphism is associated with low birth weight in offspring with a family history of type 1 diabetes.
19606063 2009 Neprilysin and insulin-degrading enzyme levels are increased in Alzheimer disease in relation to disease severity.
19602701 2009 Underlying genetic models of inheritance in established type 2 diabetes associations.
19592620 2009 Examination of type 2 diabetes loci implicates CDKAL1 as a birth weight gene.
19592050 2009 Variants in the insulin-degrading enzyme gene are associated with metabolic syndrome in Chinese elders.
19453261 2009 High-density association study of 383 candidate genes for volumetric BMD at the femoral neck and lumbar spine among older men.
19396426 2009 Glucose inhibits the insulin-induced activation of the insulin-degrading enzyme in HepG2 cells.
19383491 2009 PPARgamma transcriptionally regulates the expression of insulin-degrading enzyme in primary neurons.
19321446 2009 Molecular basis of catalytic chamber-assisted unfolding and cleavage of human insulin by human insulin-degrading enzyme.
19239107 2009 [Association of insulinase gene polymorphisms with type 2 diabetes mellitus in patients from the Moscow population].
19228808 2009 Type 2 diabetes risk alleles are associated with reduced size at birth.
19139842 2009 Risk prediction of prevalent diabetes in a Swiss population using a weighted genetic score--the CoLaus Study.
19082521 2009 Association between insulin secretion, insulin sensitivity and type 2 diabetes susceptibility variants identified in genome-wide association studies.
19053027 2009 Loci of TCF7L2, HHEX and IDE on chromosome 10q and the susceptibility of their genetic polymorphisms to type 2 diabetes.
19019493 2010 Differential cerebral deposition of IDE and NEP in sporadic and familial Alzheimer's disease.
18996360 2009 Promoter polymorphisms which modulate insulin degrading enzyme expression may increase susceptibility to Alzheimer's disease.
18986166 2008 Molecular bases for the recognition of short peptide substrates and cysteine-directed modifications of human insulin-degrading enzyme.
18984664 2009 Common type 2 diabetes risk gene variants associate with gestational diabetes.
18977241 2008 Oxidative stress, telomere length and biomarkers of physical aging in a cohort aged 79 years from the 1932 Scottish Mental Survey.
18813847 2008 Expression of metalloprotease insulin-degrading enzyme insulysin in normal and malignant human tissues.
18783335 2008 Immunohistochemical evidence of ubiquitous distribution of the metalloendoprotease insulin-degrading enzyme (IDE; insulysin) in human non-malignant tissues and tumor cell lines.
18719881 2008 Beta cell glucose sensitivity is decreased by 39% in non-diabetic individuals carrying multiple diabetes-risk alleles compared with those with no risk alleles.
18633108 2008 Common variants in CDKAL1, CDKN2A/B, IGF2BP2, SLC30A8, and HHEX/IDE genes are associated with type 2 diabetes and impaired fasting glucose in a Chinese Han population.
18621727 2008 Molecular basis for the thiol sensitivity of insulin-degrading enzyme.
18618095 2008 Variants of CDKAL1 and IGF2BP2 affect first-phase insulin secretion during hyperglycaemic clamps.
18591388 2008 Assessing the combined impact of 18 common genetic variants of modest effect sizes on type 2 diabetes risk.
18448515 2008 Evidence that the gene encoding insulin degrading enzyme influences human lifespan.
18426861 2008 Association analysis of type 2 diabetes Loci in type 1 diabetes.
18411275 2008 The catalytic domain of insulin-degrading enzyme forms a denaturant-resistant complex with amyloid beta peptide: implications for Alzheimer disease pathogenesis.
18226493 2008 Regional and cellular distribution patterns of insulin-degrading enzyme in the adult human brain and pituitary.
18212765 2008 Mechanisms of disease: genetic insights into the etiology of type 2 diabetes and obesity.
17971426 2008 Polymorphisms in the IDE-KIF11-HHEX gene locus are reproducibly associated with type 2 diabetes in a Japanese population.
17964527 2007 Regulation of protein degradation by insulin-degrading enzyme: analysis by small interfering RNA-mediated gene silencing.
17953957 2008 Association of genetic variants of insulin degrading enzyme with metabolic features in women with polycystic ovary syndrome.
17913278 2008 Association of polymorphisms in the insulin-degrading enzyme gene with type 2 diabetes in the Korean population.
17827400 2007 Studies of association of variants near the HHEX, CDKN2A/B, and IGF2BP2 genes with type 2 diabetes and impaired insulin release in 10,705 Danish subjects: validation and extension of genome-wide association studies.
17804762 2007 Common variants of the novel type 2 diabetes genes CDKAL1 and HHEX/IDE are associated with decreased pancreatic beta-cell function.
17715127 2007 Regulation of insulin secretion by SIRT4, a mitochondrial ADP-ribosyltransferase.
17613531 2007 Structure of substrate-free human insulin-degrading enzyme (IDE) and biophysical analysis of ATP-induced conformational switch of IDE.
17601350 2007 A genetic association analysis of cognitive ability and cognitive ageing using 325 markers for 109 genes associated with oxidative stress or cognition.
17579348 2007 Exploring candidate gene associations with neuropsychological performance.
17553876 2007 The amino terminus of varicella-zoster virus (VZV) glycoprotein E is required for binding to insulin-degrading enzyme, a VZV receptor.
17496198 2007 Insulin-degrading enzyme is genetically associated with Alzheimer's disease in the Finnish population.
17463249 2007 Replication of genome-wide association signals in UK samples reveals risk loci for type 2 diabetes.
17293876 2007 A genome-wide association study identifies novel risk loci for type 2 diabetes.
17244626 2007 Decreased catalytic activity of the insulin-degrading enzyme in chromosome 10-linked Alzheimer disease families.
17192785 2007 Systematic meta-analyses of Alzheimer disease genetic association studies: the AlzGene database.
17192720 2006 Insulin-degrading enzyme haplotypes affect insulin levels but not dementia risk.
17143514 2007 Immunohistochemical demonstration of the zinc metalloprotease insulin-degrading enzyme in normal and malignant human breast: correlation with tissue insulin levels.
17055432 2006 Insulin degrading enzyme is a cellular receptor mediating varicella-zoster virus infection and cell-to-cell spread.
17051221 2006 Structures of human insulin-degrading enzyme reveal a new substrate recognition mechanism.
16914266 2006 Lack of association of 5 SNPs in the vicinity of the insulin-degrading enzyme (IDE) gene with late-onset Alzheimer's disease.
16876916 2007 Positive association between risk for late-onset Alzheimer disease and genetic variation in IDE.
16675064 2007 Weak independent association signals between IDE polymorphisms, Alzheimer's disease and cognitive measures.
16574064 2006 The C-terminal domain of human insulin degrading enzyme is required for dimerization and substrate recognition.
16511862 2006 Insulin degrading enzyme is localized predominantly at the cell surface of polarized and unpolarized human cerebrovascular endothelial cell cultures.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
16380485 2006 High-density haplotype structure and association testing of the insulin-degrading enzyme (IDE) gene with type 2 diabetes in 4,206 people.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15911128 2005 Lack of association between IDE genetic variability and Down's syndrome.
15858821 2005 Mutation screening of a haplotype block around the insulin degrading enzyme gene and association with Alzheimer's disease.
15858813 2005 Association studies between risk for late-onset Alzheimer's disease and variants in insulin degrading enzyme.
15850385 2005 Alternative splicing of human insulin-degrading enzyme yields a novel isoform with a decreased ability to degrade insulin and amyloid beta-protein.
15718037 2005 Sequence variants of IDE are associated with the extent of beta-amyloid deposition in the Alzheimer's disease brain.
15590928 2004 Insulin-degrading enzyme as a downstream target of insulin receptor signaling cascade: implications for Alzheimer's disease intervention.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15489232 2004 Insulin-degrading enzyme in brain microvessels: proteolysis of amyloid {beta} vasculotropic variants and reduced activity in cerebral amyloid angiopathy.
15285718 2004 Alternative translation initiation generates a novel isoform of insulin-degrading enzyme targeted to mitochondria.
15277615 2004 Insulin-degrading enzyme and Alzheimer disease: a genetic association study in the Han Chinese.
15277398 2004 Quantitative trait loci near the insulin-degrading enzyme (IDE) gene contribute to variation in plasma insulin levels.
15181249 2004 Insulin-degrading enzyme, apolipoprotein E, and Alzheimer's disease.
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
15088150 2004 Sequence variation in the proximity of IDE may impact age at onset of both Parkinson disease and Alzheimer disease.
15024728 2004 Genetic variants in a haplotype block spanning IDE are significantly associated with plasma Abeta42 levels and risk for Alzheimer disease.
14764804 2004 Insulin-degrading activity in wound fluid.
14755451 2004 No association between the insulin degrading enzyme gene and Alzheimer's disease in a Japanese population.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14517947 2003 Genetic variation in a haplotype block spanning IDE influences Alzheimer disease.
12850277 2003 Non-covalent interaction of ubiquitin with insulin-degrading enzyme.
12765971 2003 Polymorphisms in the insulin-degrading enzyme gene are associated with type 2 diabetes in men from the NHLBI Framingham Heart Study.
12746301 2003 In vitro inhibition of insulin-degrading enzyme by long-chain fatty acids and their coenzyme A thioesters.
12716770 2003 Association and haplotype analysis of the insulin-degrading enzyme (IDE) gene, a strong positional and biological candidate for type 2 diabetes susceptibility.
12634421 2003 Insulin-degrading enzyme regulates the levels of insulin, amyloid beta-protein, and the beta-amyloid precursor protein intracellular domain in vivo.
12507914 2003 Reduced hippocampal insulin-degrading enzyme in late-onset Alzheimer's disease is associated with the apolipoprotein E-epsilon4 allele.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12161276 2002 Polymorphisms of insulin degrading enzyme gene are not associated with Alzheimer's disease.
11809755 2002 Insulin-degrading enzyme rapidly removes the beta-amyloid precursor protein intracellular domain (AICD).
11145591 2001 Identification of insulin domains important for binding to and degradation by endosomal acidic insulinase.
10684867 2000 Neurons regulate extracellular levels of amyloid beta-protein via proteolysis by insulin-degrading enzyme.
9830016 1998 Insulin-degrading enzyme regulates extracellular levels of amyloid beta-protein by degradation.
9231799 1997 Insulin-degrading enzyme does not require peroxisomal localization for insulin degradation.
9070242 1997 Overexpression of insulin degrading enzyme: cellular localization and effects on insulin signaling.
8425612 1993 The rat insulin-degrading enzyme. Molecular cloning and characterization of tissue-specific transcripts.
8077210 1994 Inducible expression and cellular localization of insulin-degrading enzyme in a stably transfected cell line.
8051160 1994 Androgen and glucocorticoid receptors interact with insulin degrading enzyme.
7731996 1995 Degradation of the cleaved leader peptide of thiolase by a peroxisomal proteinase.
6401723 1983 A high molecular weight metalloendoprotease from the cytosol of mammalian cells.
3059494 1988 Human insulin-degrading enzyme shares structural and functional homologies with E. coli protease III.
2293021 1990 Insulin-degrading enzyme: stable expression of the human complementary DNA, characterization of its protein product, and chromosomal mapping of the human and mouse genes.
1743072 1991 Localization of the gene encoding insulin-degrading enzyme to human chromosome 10, bands q23----q25.
1733942 1992 Comparison of the enzymatic and biochemical properties of human insulin-degrading enzyme and Escherichia coli protease III.
1607078 1992 Mechanisms involved in degradation of human insulin by cytosolic fractions of human, monkey, and rat liver.
758022 1978 Characteristics of the microvillus brush border of human placenta: insulin receptor localization in brush border membranes.