Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.48

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
adult high grade glioma -1.200 2.3e-02
atypical teratoid / rhabdoid tumor -1.400 2.6e-04
chronic rhinosinusitis -1.498 6.5e-03
cystic fibrosis and chronic rhinosinusit... -1.084 3.0e-02
ependymoma 1.100 1.4e-02
glioblastoma -1.900 5.4e-04
lung carcinoma 2.300 1.4e-24
medulloblastoma, large-cell -2.100 3.1e-04
osteosarcoma -1.442 3.8e-03
ovarian cancer 1.100 5.9e-09
Pick disease -1.400 1.9e-04
progressive supranuclear palsy -1.100 2.3e-02

Synonym

Accession Q8NDH6 B3KRW6 Q53P45 Q53QZ4 Q53T97 Q96N47 Q96Q32 Q9BVQ2
Symbols ALS2CR14
ALS2CR15

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (1)

AA Sequence

MDSFGQPRPEDNQSVVRRMQKKYWKTKQVFIKATGKKEDEHLVASDAELDAKLEVFHSVQETCTELLKII      1 - 70
EKYQLRLNVISEEENELGLFLKFQAERDATQAGKMMDATGKALCSSAKQRLALCTPLSRLKQEVATFSQR     71 - 140
AVSDTLMTINRMEQARTEYRGALLWMKDVSQELDPDTLKQMEKFRKVQMQVRNSKASFDKLKMDVCQKVD    141 - 210
LLGASRCNMLSHSLTTYQRTLLGFWKKTARMMSQIHEACIGFHPYDFVALKQLQDTPSKISEDNKDEQIG    211 - 280
GFLTEQLNKLVLSDEEASFESEQANKDHNEKHSQMREFGAPQFSNSENVAKDLPVDSLEGEDFEKEFSFL    281 - 350
NNLLSSGSSSTSEFTQECQTAFGSPSASLTSQEPSMGSEPLAHSSRFLPSQLFDLGFHVAGAFNNWVSQE    351 - 420
ESELCLSHTDNQPVPSQSPKKLTRSPNNGNQDMSAWFNLFADLDPLSNPDAIGHSDDELLNA            421 - 482
//

Text Mined References (9)

PMID Year Title