Property Summary

NCBI Gene PubMed Count 4
PubMed Score 7.08
PubTator Score 3.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
acute quadriplegic myopathy 1.381 7.3e-07
atypical teratoid / rhabdoid tumor 1.200 6.6e-04
Becker muscular dystrophy 1.061 6.4e-03
ovarian cancer 1.600 1.1e-05
pancreatic cancer 1.500 4.7e-03
primary pancreatic ductal adenocarcinoma 1.691 1.6e-03

 GO Function (1)

 GO Component (1)

 GO Process (1)

 Compartment GO Term (2)

AA Sequence

MALCEAAGCGSALLWPRLLLFGDSITQFSFQQGGWGASLADRLVRKCDVLNRGFSGYNTRWAKIILPRLI      1 - 70
RKGNSLDIPVAVTIFFGANDSALKDENPKQHIPLEEYAANLKSMVQYLKSVDIPENRVILITPTPLCETA     71 - 140
WEEQCIIQGCKLNRLNSVVGEYANACLQVAQDCGTDVLDLWTLMQDSQDFSSYLSDGLHLSPKGNEFLFS    141 - 210
HLWPLIEKKVSSLPLLLPYWRDVAEAKPELSLLGDGDH                                    211 - 248
//

Text Mined References (8)

PMID Year Title