Property Summary

NCBI Gene PubMed Count 4
PubMed Score 7.08
PubTator Score 3.00

Knowledge Summary


No data available


  Differential Expression (6)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.200 6.6e-04
Becker muscular dystrophy 1.061 6.4e-03
acute quadriplegic myopathy 1.381 7.3e-07
primary pancreatic ductal adenocarcinoma 1.691 1.6e-03
ovarian cancer 1.600 1.1e-05
pancreatic cancer 1.500 4.7e-03


Accession Q2TAA2 B4DMV3


  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

HLWPLIEKKVSSLPLLLPYWRDVAEAKPELSLLGDGDH                                    211 - 248

Text Mined References (8)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24159190 2014 Genome-wide association study on dimethylarginines reveals novel AGXT2 variants associated with heart rate variability but not with overall mortality.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
21269460 2011 Initial characterization of the human central proteome.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.