Property Summary

NCBI Gene PubMed Count 10
PubMed Score 43.78
PubTator Score 3.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (6)

Disease log2 FC p
osteosarcoma -2.301 4.9e-07
medulloblastoma, large-cell -1.100 2.5e-03
intraductal papillary-mucinous neoplasm ... -1.200 1.1e-02
lung cancer -1.100 6.0e-04
inflammatory breast cancer -1.200 3.7e-02
ovarian cancer -1.100 1.7e-06

Synonym

Accession Q5T013 D3DPX4 D3DPX5 Q5Q9A2 Q7Z778 Q96S83 Q9BZR3 Q9BZR4
Symbols HT036

Gene

HYI

PANTHER Protein Class (2)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (1)

PMID Text
22490543 Protein HYI may closely bind with protein P311 by an alpha helix in hypertrophic scar fibroblasts.

AA Sequence

MAPLRFSANLSWLFPELSGLPARVRAAGSSGFEAVEVAWPYAETPEALARAAREAGLRLVLINTPPGDQE      1 - 70
KGEMGLGAVPGRQAAFREGLEQAVRYAKALGCPRIHLMAGRVPQGADRIAVKAEMEAVFLENLRHAAGVL     71 - 140
AQEDLVGLLEPINTRITDPQYFLDTPQQAAAILQKVGRPNLQLQMDIFHWQIMDGNLTGNIREFLPIVGH    141 - 210
VQVAQVPGRGEPSSPGELNFPYLFQLLEDEGYKGFVGCEYQPRGDTVEGLSWLRSYWDRRGHPEAGQ       211 - 277
//

Text Mined References (13)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
22490543 2012 [Analysis of the binding domain of hydroxypyruvate isomerase homologues in hypertrophic scar fibroblasts].
19722193 2009 Low concentration of anti-7,8-dihydroxy-9,10-epoxy-7,8,9,10-tetrahydrobenzo[a]pyrene induces alterations of extracellular protein profile of exposed epithelial cells.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16341674 2005 Transcriptome analysis of human gastric cancer.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12107412 2002 Expressed sequence tag analysis of adult human iris for the NEIBank Project: steroid-response factors and similarities with retinal pigment epithelium.
10561547 1999 Biochemical evidence that Escherichia coli hyi (orf b0508, gip) gene encodes hydroxypyruvate isomerase.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.