Property Summary

NCBI Gene PubMed Count 10
PubMed Score 1.78
PubTator Score 2.40

Knowledge Summary

Patent

No data available

Expression

Gene RIF (3)

AA Sequence

MKFRAKITGKGCLELFIHVSGTVARLAKVCVLRVRPDSLCFGPAGSGGLHEARLWCEVRQGAFQQFRMEG      1 - 70
VSEDLDEIHLELTAEHLSRAARSAAGASSLKLQLTHKRRPSLTVAVELVSSLGRARSVVHDLPVRVLPRR     71 - 140
VWRDCLPPSLRASDASIRLPRWRTLRSIVERMANVGSHVLVEANLSGRMTLSIETEVVSIQSYFKNLGNP    141 - 210
PQSAVGVPENRDLESMVQVRVDNRKLLQFLEGQQIHPTTALCNIWDNTLLQLVLVQEDVSLQYFIPAL      211 - 278
//

Text Mined References (11)

PMID Year Title