Property Summary

Ligand Count 2,016
NCBI Gene PubMed Count 72
PubMed Score 213.24
PubTator Score 99.93

Knowledge Summary

Patent (25,376)

Expression

Gene RIF (64)

AA Sequence

MVPEPGPTANSTPAWGAGPPSAPGGSGWVAAALCVVIALTAAANSLLIALICTQPALRNTSNFFLVSLFT      1 - 70
SDLMVGLVVMPPAMLNALYGRWVLARGLCLLWTAFDVMCCSASILNLCLISLDRYLLILSPLRYKLRMTP     71 - 140
LRALALVLGAWSLAALASFLPLLLGWHELGHARPPVPGQCRLLASLPFVLVASGLTFFLPSGAICFTYCR    141 - 210
ILLAARKQAVQVASLTTGMASQASETLQVPRTPRPGVESADSRRLATKHSRKALKASLTLGILLGMFFVT    211 - 280
WLPFFVANIVQAVCDCISPGLFDVLTWLGYCNSTMNPIIYPLFMRDFKRALGRFLPCPRCPRERQASLAS    281 - 350
PSLRTSHSGPRPGLSLQQVLPLPLPPDSDSDSDAGSGGSSGLRLTAQLLLPGEATQDPPLPTRAAAAVNF    351 - 420
FNIDPAEPELRPHPLGIPTN                                                      421 - 440
//

Text Mined References (73)

PMID Year Title