Property Summary

Ligand Count 39
NCBI Gene PubMed Count 23
PubMed Score 35.95
PubTator Score 31.27

Knowledge Summary

Patent (8,014)

Expression

  Differential Expression (6)

Disease log2 FC p
astrocytic glioma -1.100 7.2e-03
diabetes mellitus 1.100 1.3e-03
ependymoma -1.300 1.1e-03
gastric carcinoma -1.300 1.4e-02
oligodendroglioma -1.200 3.2e-03
psoriasis -2.200 2.2e-14

Gene RIF (8)

AA Sequence

MNITNCTTEASMAIRPKTITEKMLICMTLVVITTLTTLLNLAVIMAIGTTKKLHQPANYLICSLAVTDLL      1 - 70
VAVLVMPLSIIYIVMDRWKLGYFLCEVWLSVDMTCCTCSILHLCVIALDRYWAITNAIEYARKRTAKRAA     71 - 140
LMILTVWTISIFISMPPLFWRSHRRLSPPPSQCTIQHDHVIYTIYSTLGAFYIPLTLILILYYRIYHAAK    141 - 210
SLYQKRGSSRHLSNRSTDSQNSFASCKLTQTFCVSDFSTSDPTTEFEKFHASIRIPPFDNDLDHPGERQQ    211 - 280
ISSTRERKAARILGLILGAFILSWLPFFIKELIVGLSIYTVSSEVADFLTWLGYVNSLINPLLYTSFNED    281 - 350
FKLAFKKLIRCREHT                                                           351 - 365
//

Text Mined References (27)

PMID Year Title